GapMind for catabolism of small carbon sources

 

Aligments for a candidate for rbsA in Escherichia coli BW25113

Align Ribose import ATP-binding protein RbsA 2, component of D-ribose porter (Nanavati et al., 2006). Induced by ribose (characterized)
to candidate 17628 b3567 fused D-xylose transporter subunits of ABC superfamily: ATP-binding components (NCBI)

Query= TCDB::Q9X051
         (523 letters)



>lcl|FitnessBrowser__Keio:17628 b3567 fused D-xylose transporter
           subunits of ABC superfamily: ATP-binding components
           (NCBI)
          Length = 513

 Score =  436 bits (1121), Expect = e-126
 Identities = 224/509 (44%), Positives = 339/509 (66%), Gaps = 6/509 (1%)

Query: 12  LLEARNITKTFPGVIAVNNVTLQIYKGEVCALVGENGAGKSTLMKILAGVYP--DYEGQI 69
           LLE +NITKTF  V A++NV L++  GE+ +L GENG+GKSTLMK+L G+YP   YEG+I
Sbjct: 4   LLEMKNITKTFGSVKAIDNVCLRLNAGEIVSLCGENGSGKSTLMKVLCGIYPHGSYEGEI 63

Query: 70  FLEGKEVRFRNPREAQENGIALIPQELDLVPNLSSAENIFLSREPVNEFGVIEYQKMFEQ 129
              G+E++  + R+ +  GIA+I QEL LV  L+  ENIFL  E +   G+++Y  M  +
Sbjct: 64  IFAGEEIQASHIRDTERKGIAIIHQELALVKELTVLENIFLGNE-ITHNGIMDYDLMTLR 122

Query: 130 ASKLFSKLGVNIDPKTKVEDLSTSQQQMVAIAKALSLDAKIIIMDEPTSAIGKRETEQLF 189
             KL +++ ++I P T+V DL   QQQ+V IAKAL+   +++I+DEPT+++ ++ET  L 
Sbjct: 123 CQKLLAQVSLSISPDTRVGDLGLGQQQLVEIAKALNKQVRLLILDEPTASLTEQETSILL 182

Query: 190 NIIRSLKNEGKSVIYISHRLEEIFEIADRVVVMRDGRKVGEGPIEEFDHDKLVRLMVGRS 249
           +IIR L+  G + IYISH+L E+  I+D + V+RDG+ +G         D ++ +MVGR 
Sbjct: 183 DIIRDLQQHGIACIYISHKLNEVKAISDTICVIRDGQHIGTRDAAGMSEDDIITMMVGRE 242

Query: 250 IDQFFIKERATITDEIFRVEGIKLWS-LDRKKLLVDDVSFYVRKGEVLGIYGLVGAGRTE 308
           +   +  E  T  DEI R+E +  W  ++R    V+DVSF +++GE+LGI GLVGAGRTE
Sbjct: 243 LTALYPNEPHTTGDEILRIEHLTAWHPVNRHIKRVNDVSFSLKRGEILGIAGLVGAGRTE 302

Query: 309 LLEAIFGAHPGRTEGKVFIGGKEIKIHSPRDAVKNGIGLVPEDRKTAGLILQMSVLHNIT 368
            ++ +FG  PG+ EGK++I GK++ I + + A+  GI +VPEDRK  G++  M+V  NIT
Sbjct: 303 TIQCLFGVWPGQWEGKIYIDGKQVDIRNCQQAIAQGIAMVPEDRKRDGIVPVMAVGKNIT 362

Query: 369 LPSVVMKLIVRKFGLIDSQLEKEIVRSFIEKLNIKTPSPYQIVENLSGGNQQKVVLAKWL 428
           L +  +         +D   E++ +   I++L +KT SP   +  LSGGNQQK +LA+ L
Sbjct: 363 LAA--LNKFTGGISQLDDAAEQKCILESIQQLKVKTSSPDLAIGRLSGGNQQKAILARCL 420

Query: 429 AIKPKVLLLDEPTRGIDVNAKSEIYKLISEMAVSGMGVVMVSSELPEILAMSDRILVMSE 488
            + P++L+LDEPTRGID+ AK EIYKLI+++   G+ V+++SSELPE+L +SDR+LVM E
Sbjct: 421 LLNPRILILDEPTRGIDIGAKYEIYKLINQLVQQGIAVIVISSELPEVLGLSDRVLVMHE 480

Query: 489 GRKTAEFLREEVTEEDLLKAAIPRSVKVE 517
           G+  A  +   +T+E +++AA+     VE
Sbjct: 481 GKLKANLINHNLTQEQVMEAALRSEHHVE 509


Lambda     K      H
   0.317    0.137    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 642
Number of extensions: 36
Number of successful extensions: 11
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 523
Length of database: 513
Length adjustment: 35
Effective length of query: 488
Effective length of database: 478
Effective search space:   233264
Effective search space used:   233264
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory