Align Ribokinase; RK; EC 2.7.1.15 (uncharacterized)
to candidate 17923 b3883 putative kinase (VIMSS)
Query= curated2:Q9K6K1 (294 letters) >FitnessBrowser__Keio:17923 Length = 298 Score = 115 bits (288), Expect = 1e-30 Identities = 96/295 (32%), Positives = 141/295 (47%), Gaps = 15/295 (5%) Query: 6 ITVVGSINMDMVTITDVVPVQGETVLGKDFRTVPGGKGANQAVAAARLGANVRMIGRVGD 65 + VG MD + + +P + + +++ V GG A AVAAARLGA V IGRVGD Sbjct: 4 VACVGITVMDRIYYVEGLPTESGKYVARNYTEVGGGPAATAAVAAARLGAQVDFIGRVGD 63 Query: 66 DPFGHVLTENLAKEGIITDSVKPVTDCTSGVATILLSDRDNRIIVTKGANEHVTPDYVAA 125 D G+ L L G+ T K S + I++ + RII+ + + + PD Sbjct: 64 DDTGNSLLAELESWGVNTRYTKRYNQAKSSQSAIMVDTKGERIIINYPSPD-LLPDAEWL 122 Query: 126 FEQELAASDVVLLQLEIPLETVAYVLEFCAKHHVTTVLNP--APAQKLPDAAWTDATYIS 183 E + + DVVL + + + V TVL+ P A +D S Sbjct: 123 EEIDFSQWDVVLADVRWH-DGAKKAFTLARQAGVMTVLDGDITPQDISELVALSDHAAFS 181 Query: 184 PNENECLQLFG-DEPDANLRQ-------KLIMTKGADGVQFYENDEQVQVESFRVEPVDT 235 E +L G E + L+Q + +T+G+ G + EN + +F+V+ VDT Sbjct: 182 --EPGLARLTGVKEMASALKQAQTLTNGHVYVTQGSAGCDWLENGGRQHQPAFKVDVVDT 239 Query: 236 TGAGDTFNGAFAVALG-GGTVKEAVRFANAAAALSVQSFGAQGGMPTKAQVQSFL 289 TGAGD F+GA AVAL G + E+VRFA+ AAL G + G+P Q +SFL Sbjct: 240 TGAGDVFHGALAVALATSGDLAESVRFASGVAALKCTRPGGRAGIPDCDQTRSFL 294 Lambda K H 0.315 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 228 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 298 Length adjustment: 26 Effective length of query: 268 Effective length of database: 272 Effective search space: 72896 Effective search space used: 72896 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory