Align Sorbitol (D-Glucitol):H+ co-transporter, SOT1 (Km for sorbitol of 0.64 mM) of 509 aas and 12 TMSs (Gao et al. 2003). SOT1 of P. cerasus is expressed throughout fruit development, but especially when growth and sorbitol accumulation rates are highest. In leaves, PcSOT1 expression is highest in young, expanding tissues, but substantially less in mature leaves (characterized)
to candidate 17022 b2943 D-galactose transporter (NCBI)
Query= TCDB::AIU41385.1 (509 letters) >FitnessBrowser__Keio:17022 Length = 464 Score = 236 bits (601), Expect = 2e-66 Identities = 140/453 (30%), Positives = 243/453 (53%), Gaps = 25/453 (5%) Query: 33 LASMTSILLGYDIGVMSGASIYIQEDLKISDVEVEILIGILNLYSLIGSAAAGRTSDWIG 92 LA++ +L G DIGV++GA +I ++ +I+ E ++ + + +G+ +G S +G Sbjct: 21 LAALAGLLFGLDIGVIAGALPFIADEFQITSHTQEWVVSSMMFGAAVGAVGSGWLSFKLG 80 Query: 93 RRYTIVFAGAIFFTGALLMGFATNYAFLMVGRFVAGIGVGYALMIAPVYNAEVSPASSRG 152 R+ +++ +F G+L A N L++ R + G+ VG A AP+Y +E++P RG Sbjct: 81 RKKSLMIGAILFVAGSLFSAAAPNVEVLILSRVLLGLAVGVASYTAPLYLSEIAPEKIRG 140 Query: 153 ALTSFPEVFVNIGILLGYVANYAFSGLPINLGWRLMLGVGVFPSVILAVGVLTMPESPRW 212 ++ S ++ + IGIL Y+++ AFS WR MLGV + P+++L +GV +P+SPRW Sbjct: 141 SMISMYQLMITIGILGAYLSDTAFS---YTGAWRWMLGVIIIPAILLLIGVFFLPDSPRW 197 Query: 213 LVMQGRLGDAKHVLDKTSDSLEEAQLRLADIKEAAGIPEHCTEDVVQVPKHSHGEEVWKE 272 + R DA+ VL + D+ EA+ L +I+E+ + + G ++KE Sbjct: 198 FAAKRRFVDAERVLLRLRDTSAEAKRELDEIRESLQVKQ-------------SGWALFKE 244 Query: 273 LLLHPTPPVRHILIAAVGFHFFQQMSGIDALVLYSPRIFRASGITDSSTLLLATVAVGFS 332 R + V QQ +G++ ++ Y+P+IF +G T+++ + TV VG + Sbjct: 245 -----NSNFRRAVFLGVLLQVMQQFTGMNVIMYYAPKIFELAGYTNTTEQMWGTVIVGLT 299 Query: 333 KTIFTLIAIGFLDRVGRRPLLLTSVAGMIASLLCLGTSLTIVDHEKEKMMWASVVCLTMV 392 + T IAIG +DR GR+P L M A + LGT + I H +A + M+ Sbjct: 300 NVLATFIAIGLVDRWGRKPTLTLGFLVMAAGMGVLGTMMHIGIHSPSAQYFA----IAML 355 Query: 393 LAYVGFFSIGMGPIAWVYSSEIFPLKLRAQGCSMGTAVNRIMSGVLTMTFITLYKAITMG 452 L ++ F++ GP+ WV SEI PLK R G + TA N I + ++ TF+T+ + Sbjct: 356 LMFIVGFAMSAGPLIWVLCSEIQPLKGRDFGITCSTATNWIANMIVGATFLTMLNTLGNA 415 Query: 453 GTFFLYGAIATVGWVFFYTMLPETQGRTLEDME 485 TF++Y A+ + + ++PET+ +LE +E Sbjct: 416 NTFWVYAALNVLFILLTLWLVPETKHVSLEHIE 448 Lambda K H 0.326 0.140 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 701 Number of extensions: 44 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 509 Length of database: 464 Length adjustment: 34 Effective length of query: 475 Effective length of database: 430 Effective search space: 204250 Effective search space used: 204250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory