Align sorbitol-6-phosphate dehydrogenase subunit (EC 1.1.1.140) (characterized)
to candidate 16525 b2426 putative oxidoreductase (VIMSS)
Query= metacyc::MONOMER-13092 (266 letters) >FitnessBrowser__Keio:16525 Length = 263 Score = 105 bits (262), Expect = 1e-27 Identities = 82/267 (30%), Positives = 124/267 (46%), Gaps = 25/267 (9%) Query: 7 IAGKTVIVTGASSGIGKAIVDELLSLKVKVANFDLTDNGEKHENLLFQK--------VDV 58 + GKT ++TGA GIG+ I + D++ EK + L + DV Sbjct: 4 LTGKTALITGALQGIGEGIARTFARHGANLILLDISPEIEKLADELCGRGHRCTAVVADV 63 Query: 59 TSREQVEASVAAVVEHFGTVDAVVNNAGINIPRLLVDPKDPHGQYELDDATFEKITMINQ 118 V A++ E G +D +VNNAG+ +D D + +D IN Sbjct: 64 RDPASVAAAIKRAKEKEGRIDILVNNAGVCRLGSFLDMSDDDRDFHID---------INI 114 Query: 119 KGLYLVSQAVGRLLVAKKKGVIINMASEAG-LEGSEGQSAYAGTKAAVYSYTRSWAKELG 177 KG++ V++AV ++A+K G I+ M+S G + G++AYA TKAA+ T+S A E Sbjct: 115 KGVWNVTKAVLPEMIARKDGRIVMMSSVTGDMVADPGETAYALTKAAIVGLTKSLAVEYA 174 Query: 178 KYGVRVVGIAPGIMEATGLRTLAYEEALGYTRGKTVEEIRAGYASTTTTPLGRSGKLSEV 237 + G+RV I PG +RT E + + E + A P+ R EV Sbjct: 175 QSGIRVNAICPGY-----VRTPMAESIARQSNPEDPESVLTEMAK--AIPMRRLADPLEV 227 Query: 238 ADLVAYYISDRSSYITGITTNVAGGKT 264 +L A+ SD SSY+TG + GG T Sbjct: 228 GELAAFLASDESSYLTGTQNVIDGGST 254 Lambda K H 0.313 0.131 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 159 Number of extensions: 12 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 266 Length of database: 263 Length adjustment: 25 Effective length of query: 241 Effective length of database: 238 Effective search space: 57358 Effective search space used: 57358 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory