GapMind for catabolism of small carbon sources

 

Aligments for a candidate for SSS-glucose in Escherichia coli BW25113

Align Sodium/glucose cotransporter; Na(+)/glucose symporter (characterized)
to candidate 17739 b3679 predicted transporter (NCBI)

Query= SwissProt::P96169
         (543 letters)



>lcl|FitnessBrowser__Keio:17739 b3679 predicted transporter (NCBI)
          Length = 571

 Score =  225 bits (573), Expect = 4e-63
 Identities = 159/549 (28%), Positives = 272/549 (49%), Gaps = 47/549 (8%)

Query: 8   LSFIDIMVFAIYVAIIIGVGLWVSRDKKGTQKSTEDYFLAGKSLPWWAVGASLIAANISA 67
           ++ + I+ F  +  ++  +  W  R  K    S + YFLAG+SL    + ASL+  N+S 
Sbjct: 1   MNSLQILSFVGFTLLVAVITWWKVR--KTDTGSQQGYFLAGRSLKAPVIAASLMLTNLST 58

Query: 68  EQFIGMSGSGYSIGLAIASYEWMSAITLIIVGKYFLPIFIEKGIYTIPEFVEKRFNKKLK 127
           EQ +G+SG  Y  G+++  +E  SA+TLI +   FLP ++++GI TIP+F+E+R++K  +
Sbjct: 59  EQLVGLSGQAYKSGMSVMGWEVTSAVTLIFLALIFLPRYLKRGIATIPDFLEERYDKTTR 118

Query: 128 TILAVFWISLYIFVNLTSVLYLGGLALETIL----------GIPLMYSILGLALFALVYS 177
            I+   ++       L  VLY G LAL ++           G  +   ++ L L  ++Y+
Sbjct: 119 IIIDFCFLIATGVCFLPIVLYSGALALNSLFHVGESLQISHGAAIWLLVILLGLAGILYA 178

Query: 178 IYGGLSAVVWTDVIQVFFLVLGGFMTTYMAVSFIGGTDGWFAGVSKMVDAAPGHFEMILD 237
           + GGL A+   D I    LV+GG M     +  + G   +  G+ ++          I  
Sbjct: 179 VIGGLRAMAVADSINGIGLVIGGLMVPVFGLIAM-GKGSFMQGIEQLTTVHAEKLNSIGG 237

Query: 238 QSNPQYMNLPGIAVLIGGLWVANLYYWGFNQYIIQRTLAAKSVSEAQKGIVFAAFLKLIV 297
            ++P    LP I     GL + N +YW  NQ I+QRTLA+KS++E QKG +  A LK++ 
Sbjct: 238 PTDP----LP-IGAAFTGLILVNTFYWCTNQGIVQRTLASKSLAEGQKGALLTAVLKMLD 292

Query: 298 PFLVVLPGIAAYVITSDPQLMASLGDIAATNLPSAANADKAYPWL-TQFLPVGVKGVVFA 356
           P ++VLPG+ A+ +  D              LP    AD AYP L    LPV + G   A
Sbjct: 293 PLVLVLPGLIAFHLYQD--------------LP---KADMAYPTLVNNVLPVPMVGFFGA 335

Query: 357 ALAAAIVSSLASMLNSTATIFTMDIYKEYISPDSGDHKLVNVGRTAAVVALIIACLIAPM 416
            L  A++S+    LNS +T+F+M IY+  I+ ++   +LV VGR       I++ L+AP 
Sbjct: 336 VLFGAVISTFNGFLNSASTLFSMGIYRRIINQNAEPQQLVTVGRKFGFFIAIVSVLVAPW 395

Query: 417 LGGIGQA-FQYIQEYTGLVSPGILAVFLLGLFWKKTTSKGAIIGVVASIPFALFLKFMPL 475
           +    Q  + ++++  G+ +  ++ + ++G F+ +  +  A + +   I   + + ++  
Sbjct: 396 IANAPQGLYSWMKQLNGIYNVPLVTIIIMGFFFPRIPALAAKVAMGIGIISYITINYL-- 453

Query: 476 SMPFMDQMLYTLLFTMVVIAFTSLSTSINDDDPKGISVT-SSMFVTD----RSFNIAAYG 530
            + F    LY L  T  +     L   I    P+    T    F  D    ++  IA+ G
Sbjct: 454 -VKFDFHFLYVLACTFCINVVVML--VIGFIKPRATPFTFKDAFAVDMKPWKNVKIASIG 510

Query: 531 IMIVLAVLY 539
           I+  +  +Y
Sbjct: 511 ILFAMIGVY 519


Lambda     K      H
   0.326    0.141    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 857
Number of extensions: 60
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 543
Length of database: 571
Length adjustment: 36
Effective length of query: 507
Effective length of database: 535
Effective search space:   271245
Effective search space used:   271245
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory