Align AraV, component of Arabinose, fructose, xylose porter (characterized)
to candidate 17511 b3450 ATP-binding component of sn-glycerol 3-phosphate transport system (VIMSS)
Query= TCDB::Q97UF2 (371 letters) >FitnessBrowser__Keio:17511 Length = 356 Score = 201 bits (512), Expect = 2e-56 Identities = 115/297 (38%), Positives = 185/297 (62%), Gaps = 16/297 (5%) Query: 1 MTTIRVENLSKIFKKGKTEVKAVDNVSITIDSGMAFGVLGPSGHGKTTFLRLIAGLEEPT 60 M ++++ ++K + GKT+V + +++ + G ++GPSG GK+T LR++AGLE T Sbjct: 1 MAGLKLQAVTKSWD-GKTQV--IKPLTLDVADGEFIVMVGPSGCGKSTLLRMVAGLERVT 57 Query: 61 SGYIYFDNEAVSSPRRVMMSPEKRGIAMVFQNWALYPNMTVFDNIAFPLKLAKVPKDKIE 120 G I+ +++ V+ M P+ RGIAMVFQN+ALYP+M+V +N+A+ LK+ + K +I Sbjct: 58 EGDIWINDQRVTE-----MEPKDRGIAMVFQNYALYPHMSVEENMAWGLKIRGMGKQQIA 112 Query: 121 NKVKEVSEELGLSGVLNRYPKELSGGQMQRTAIARALVKDPKVLLLDEPFSNLDAQIRES 180 +VKE + L L G+L R P+ELSGGQ QR A+ RA+V+DP V L DEP SNLDA++R Sbjct: 113 ERVKEAARILELDGLLKRRPRELSGGQRQRVAMGRAIVRDPAVFLFDEPLSNLDAKLRVQ 172 Query: 181 ARALVRKIQRERKLTTLIVSHDPADIFAIANKAGVIVNGKFAQIGTPTEIYEYPATDLIA 240 R ++++ R K T+L V+HD + +A + V+ G QIGTP E+YE PA+ +A Sbjct: 173 MRLELQQLHRRLKTTSLYVTHDQVEAMTLAQRVMVMNGGVAEQIGTPVEVYEKPASLFVA 232 Query: 241 RLTGE--INLIQAKIIENNA---IIANLKVPLNN--MELKGQSNIVIGLRPDDLTLS 290 G +NL+ ++ + +++PLN + G+ + +G+RP+ + LS Sbjct: 233 SFIGSPAMNLLTGRVNNEGTHFELDGGIELPLNGGYRQYAGR-KMTLGIRPEHIALS 288 Lambda K H 0.317 0.136 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 296 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 356 Length adjustment: 29 Effective length of query: 342 Effective length of database: 327 Effective search space: 111834 Effective search space used: 111834 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory