Align fructose-bisphosphate aldolase (EC 4.1.2.13) (characterized)
to candidate 15891 b1773 predicted aldolase (NCBI)
Query= BRENDA::I3EBM6 (285 letters) >FitnessBrowser__Keio:15891 Length = 278 Score = 185 bits (469), Expect = 1e-51 Identities = 115/279 (41%), Positives = 161/279 (57%), Gaps = 15/279 (5%) Query: 11 NKAKAEGYAVGQFNLNNLEFTQAILLAAEEEKSPVILGVSEGAGRYMGG--FKTVVNMVK 68 N A + YA+ FN+ N E ++ AAEE KSPVI+ G ++G F+ +M+ Sbjct: 10 NDATNKHYAIAHFNVWNAEMLMGVIDAAEEAKSPVIISFGTG---FVGNTSFEDFSHMMV 66 Query: 69 GLMEDYKITVPVAIHLDHGSSFEKCKEVIDAGFTSVMIDASHHPFEENVEVTKKVVEYAH 128 + + K TVPV H DHG S E G S+M DAS FEEN+ +TK+ V++ H Sbjct: 67 SMAQ--KATVPVITHWDHGRSMEIIHNAWTHGMNSLMRDASAFDFEENIRLTKEAVDFFH 124 Query: 129 ARGVSVEAELGTVGGQE--DDVIADGVIYADPKECEELVKRTGIDCLAPALGSVHGPYKG 186 G+ VEAELG VG + ++ +A G Y DP + E V+RTG D LA A+G+ HG Y Sbjct: 125 PLGIPVEAELGHVGNETVYEEALA-GYHYTDPDQAAEFVERTGCDSLAVAIGNQHGVYTS 183 Query: 187 EPNLGFKEMEEIGRITGVPLVLHGGTGIPTKDIQRAISLGTAKINVNTENQIASAKKVRE 246 EP L F+ ++ + VPLVLHG +GI DI+ AISLG AKIN++TE A+ V+E Sbjct: 184 EPQLNFEVVKRVRDAVSVPLVLHGASGISDADIKTAISLGIAKINIHTELCQAAMVAVKE 243 Query: 247 VLAENPNMYDPRKYLGPARDAIKETVIGKMREFGSSGKA 285 + P ++ R+ R A+KE + K++ FGS GKA Sbjct: 244 -NQDQPFLHLERE----VRKAVKERALEKIKLFGSDGKA 277 Lambda K H 0.314 0.134 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 205 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 285 Length of database: 278 Length adjustment: 26 Effective length of query: 259 Effective length of database: 252 Effective search space: 65268 Effective search space used: 65268 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory