Align Glyoxal reductase; GR; Methylglyoxal reductase; EC 1.1.1.-; EC 1.1.1.283 (characterized)
to candidate 15899 b1781 predicted oxidoreductase (NCBI)
Query= SwissProt::O32210 (276 letters) >FitnessBrowser__Keio:15899 Length = 284 Score = 135 bits (341), Expect = 8e-37 Identities = 95/269 (35%), Positives = 150/269 (55%), Gaps = 23/269 (8%) Query: 9 VKLHNGVEMPWFGLGVFKVENGNEATE------SVKAAIKNGYRSIDTAAIYKN---EEG 59 ++ V +P G G + + G +A++ +++A I+ G IDTA +Y + E+ Sbjct: 6 IQFSGDVSLPAVGQGTWYM--GEDASQRKTEVAALRAGIELGLTLIDTAEMYADGGAEKV 63 Query: 60 VGIGIKESGVAREELFITSKVWNEDQGYETTLAAFEKSLERLQLDYLDLYLIHWPGKDKY 119 VG + +G+ RE++F+ SKV+ + G + + A E SL RL DYLDLYL+HW G + Sbjct: 64 VGEAL--TGL-REKVFLVSKVYPWNAGGQKAINACEASLRRLNTDYLDLYLLHWSGSFAF 120 Query: 120 KDTWRALEKLYKDGKIRAIGVSNFQVHHLEELLK-DAEIKPMVNQVEFH--PRLTQKELR 176 ++T A+EKL GKIR GVSN ++EL + + NQV +H R + +L Sbjct: 121 EETVAAMEKLIAQGKIRRWGVSNLDYADMQELWQLPGGNQCATNQVLYHLGSRGIEYDLL 180 Query: 177 DYCKGQGIQLEAWSPLMQ-----GQLLDNEVLTQIAEKHNKSVAQVILRWDLQH-GVVTI 230 +C+ Q + + A+SPL Q LL N V+ +IA HN S AQV+L W + H GV+ I Sbjct: 181 PWCQQQQMPVMAYSPLAQAGRLRNGLLKNAVVNEIAHAHNISAAQVLLAWVISHQGVMAI 240 Query: 231 PKSIKEHRIIENADIFDFELSQEDMDKID 259 PK+ + +NA + + ELS ++ +D Sbjct: 241 PKAATIAHVQQNAAVLEVELSSAELAMLD 269 Lambda K H 0.316 0.135 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 196 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 284 Length adjustment: 26 Effective length of query: 250 Effective length of database: 258 Effective search space: 64500 Effective search space used: 64500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory