Align nucleoside permease nupG (characterized)
to candidate 16205 b2098 predicted nucleoside transporter (NCBI)
Query= CharProtDB::CH_088596 (418 letters) >FitnessBrowser__Keio:16205 Length = 425 Score = 208 bits (530), Expect = 2e-58 Identities = 127/417 (30%), Positives = 218/417 (52%), Gaps = 30/417 (7%) Query: 1 MNLKLQLKILSFLQFCLWGSWLTTLGSYMFVTLKFDGASIGAVYSSLGIAAVFMPALLGI 60 M +L + F+++ +WG+W L ++ + F IG Y+ IAA+ P L+G Sbjct: 1 MKTTAKLSFMMFVEWFIWGAWFVPLWLWLSKS-GFSAGEIGWSYACTAIAAILSPILVGS 59 Query: 61 VADKWLSAKWVYAICHTIGAITLFMAAQVTTPEAMFLVILINSFAYMPTLGLINTISYYR 120 + D++ SA+ V A+ GA+ ++ AAQ TT F ++L S YMPT+ L N+I++ Sbjct: 60 ITDRFFSAQKVLAVLMFAGALLMYFAAQQTTFAGFFPLLLAYSLTYMPTIALTNSIAFAN 119 Query: 121 LQNAGMDIVTDFPPIRIWGTIGFIMA-------MWVVSLSGFELSHMQLYIGAALSAILV 173 + D+ DFP IR+ GTIG+I + ++ + +++ L I A SA+L Sbjct: 120 VP----DVERDFPRIRVMGTIGWIASGLACGFLPQILGYADISPTNIPLLITAGSSALLG 175 Query: 174 LFTLTLPHIPVAKQQANQSWTTLLGLDAFALFKNKRMAIFFIFSMLLGAELQITNMFGNT 233 +F LP P K +LGLDA L ++K +FF S L L +F N Sbjct: 176 VFAFFLPDTP-PKSTGKMDIKVMLGLDALILLRDKNFLVFFFCSFLFAMPLAFYYIFANG 234 Query: 234 FLHSFDKDPMFASSFIVQHASIIMSISQISETLFILTIPFFLSRYGIKNVMMISIVAWIL 293 +L + +++A+ M++ Q SE F+L +PFF R+GIK V+++ +V + Sbjct: 235 YL----------TEVGMKNATGWMTLGQFSEIFFMLALPFFTKRFGIKKVLLLGLVTAAI 284 Query: 294 RFALFAYGDPTPFGT-VLLVLSMIVYGCAFDFFNISGSVFVEKEVSPAIRASAQGMFLMM 352 R+ F YG + T LL L ++++G ++DF+ ++ ++V+K+ +R +AQG+ + Sbjct: 285 RYGFFIYGSADEYFTYALLFLGILLHGVSYDFYYVTAYIYVDKKAPVHMRTAAQGLITLC 344 Query: 353 TNGFGCILGGIVSGKVVE-MYTQ----NGIT-DWQTVWLIFAGYSVVLAFAFMAMFK 403 GFG +LG + G ++E M+ NG+T +W +W A ++A FM F+ Sbjct: 345 CQGFGSLLGYRLGGVMMEKMFAYQEPVNGLTFNWSGMWTFGAVMIAIIAVLFMIFFR 401 Lambda K H 0.331 0.141 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 566 Number of extensions: 35 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 418 Length of database: 425 Length adjustment: 32 Effective length of query: 386 Effective length of database: 393 Effective search space: 151698 Effective search space used: 151698 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory