GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nupG in Escherichia coli BW25113

Align nucleoside permease nupG (characterized)
to candidate 16205 b2098 predicted nucleoside transporter (NCBI)

Query= CharProtDB::CH_088596
         (418 letters)



>lcl|FitnessBrowser__Keio:16205 b2098 predicted nucleoside
           transporter (NCBI)
          Length = 425

 Score =  208 bits (530), Expect = 2e-58
 Identities = 127/417 (30%), Positives = 218/417 (52%), Gaps = 30/417 (7%)

Query: 1   MNLKLQLKILSFLQFCLWGSWLTTLGSYMFVTLKFDGASIGAVYSSLGIAAVFMPALLGI 60
           M    +L  + F+++ +WG+W   L  ++  +  F    IG  Y+   IAA+  P L+G 
Sbjct: 1   MKTTAKLSFMMFVEWFIWGAWFVPLWLWLSKS-GFSAGEIGWSYACTAIAAILSPILVGS 59

Query: 61  VADKWLSAKWVYAICHTIGAITLFMAAQVTTPEAMFLVILINSFAYMPTLGLINTISYYR 120
           + D++ SA+ V A+    GA+ ++ AAQ TT    F ++L  S  YMPT+ L N+I++  
Sbjct: 60  ITDRFFSAQKVLAVLMFAGALLMYFAAQQTTFAGFFPLLLAYSLTYMPTIALTNSIAFAN 119

Query: 121 LQNAGMDIVTDFPPIRIWGTIGFIMA-------MWVVSLSGFELSHMQLYIGAALSAILV 173
           +     D+  DFP IR+ GTIG+I +         ++  +    +++ L I A  SA+L 
Sbjct: 120 VP----DVERDFPRIRVMGTIGWIASGLACGFLPQILGYADISPTNIPLLITAGSSALLG 175

Query: 174 LFTLTLPHIPVAKQQANQSWTTLLGLDAFALFKNKRMAIFFIFSMLLGAELQITNMFGNT 233
           +F   LP  P  K         +LGLDA  L ++K   +FF  S L    L    +F N 
Sbjct: 176 VFAFFLPDTP-PKSTGKMDIKVMLGLDALILLRDKNFLVFFFCSFLFAMPLAFYYIFANG 234

Query: 234 FLHSFDKDPMFASSFIVQHASIIMSISQISETLFILTIPFFLSRYGIKNVMMISIVAWIL 293
           +L          +   +++A+  M++ Q SE  F+L +PFF  R+GIK V+++ +V   +
Sbjct: 235 YL----------TEVGMKNATGWMTLGQFSEIFFMLALPFFTKRFGIKKVLLLGLVTAAI 284

Query: 294 RFALFAYGDPTPFGT-VLLVLSMIVYGCAFDFFNISGSVFVEKEVSPAIRASAQGMFLMM 352
           R+  F YG    + T  LL L ++++G ++DF+ ++  ++V+K+    +R +AQG+  + 
Sbjct: 285 RYGFFIYGSADEYFTYALLFLGILLHGVSYDFYYVTAYIYVDKKAPVHMRTAAQGLITLC 344

Query: 353 TNGFGCILGGIVSGKVVE-MYTQ----NGIT-DWQTVWLIFAGYSVVLAFAFMAMFK 403
             GFG +LG  + G ++E M+      NG+T +W  +W   A    ++A  FM  F+
Sbjct: 345 CQGFGSLLGYRLGGVMMEKMFAYQEPVNGLTFNWSGMWTFGAVMIAIIAVLFMIFFR 401


Lambda     K      H
   0.331    0.141    0.436 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 566
Number of extensions: 35
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 418
Length of database: 425
Length adjustment: 32
Effective length of query: 386
Effective length of database: 393
Effective search space:   151698
Effective search space used:   151698
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory