Align Beta-phosphoglucomutase; Beta-PGM; EC 5.4.2.6 (characterized)
to candidate 15437 b1317 predicted beta-phosphoglucomutase (NCBI)
Query= SwissProt::P77366 (219 letters) >FitnessBrowser__Keio:15437 Length = 219 Score = 429 bits (1103), Expect = e-125 Identities = 219/219 (100%), Positives = 219/219 (100%) Query: 1 MKLQGVIFDLDGVITDTAHLHFQAWQQIAAEIGISIDAQFNESLKGISRDESLRRILQHG 60 MKLQGVIFDLDGVITDTAHLHFQAWQQIAAEIGISIDAQFNESLKGISRDESLRRILQHG Sbjct: 1 MKLQGVIFDLDGVITDTAHLHFQAWQQIAAEIGISIDAQFNESLKGISRDESLRRILQHG 60 Query: 61 GKEGDFNSQERAQLAYRKNLLYVHSLRELTVNAVLPGIRSLLADLRAQQISVGLASVSLN 120 GKEGDFNSQERAQLAYRKNLLYVHSLRELTVNAVLPGIRSLLADLRAQQISVGLASVSLN Sbjct: 61 GKEGDFNSQERAQLAYRKNLLYVHSLRELTVNAVLPGIRSLLADLRAQQISVGLASVSLN 120 Query: 121 APTILAALELREFFTFCADASQLKNSKPDPEIFLAACAGLGVPPQACIGIEDAQAGIDAI 180 APTILAALELREFFTFCADASQLKNSKPDPEIFLAACAGLGVPPQACIGIEDAQAGIDAI Sbjct: 121 APTILAALELREFFTFCADASQLKNSKPDPEIFLAACAGLGVPPQACIGIEDAQAGIDAI 180 Query: 181 NASGMRSVGIGAGLTGAQLLLPSTESLTWPRLSAFWQNV 219 NASGMRSVGIGAGLTGAQLLLPSTESLTWPRLSAFWQNV Sbjct: 181 NASGMRSVGIGAGLTGAQLLLPSTESLTWPRLSAFWQNV 219 Lambda K H 0.320 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 321 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 219 Length of database: 219 Length adjustment: 22 Effective length of query: 197 Effective length of database: 197 Effective search space: 38809 Effective search space used: 38809 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
Align candidate 15437 b1317 (predicted beta-phosphoglucomutase (NCBI))
to HMM TIGR01990 (pgmB: beta-phosphoglucomutase (EC 5.4.2.6))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01990.hmm # target sequence database: /tmp/gapView.1786525.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01990 [M=187] Accession: TIGR01990 Description: bPGM: beta-phosphoglucomutase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-86 274.8 0.0 2.4e-86 274.6 0.0 1.0 1 lcl|FitnessBrowser__Keio:15437 b1317 predicted beta-phosphogluc Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Keio:15437 b1317 predicted beta-phosphoglucomutase (NCBI) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 274.6 0.0 2.4e-86 2.4e-86 1 187 [] 3 191 .. 3 191 .. 0.99 Alignments for each domain: == domain 1 score: 274.6 bits; conditional E-value: 2.4e-86 TIGR01990 1 lkaviFDlDGvitdtaeyhylawkkladelgiefdeelnesLkGvsReesleailkkakk..kyseeekeelaerknek 77 l++viFDlDGvitdta++h++aw+++a+e+gi++d ++nesLkG+sR+esl++il++++k +++++e+++la rkn lcl|FitnessBrowser__Keio:15437 3 LQGVIFDLDGVITDTAHLHFQAWQQIAAEIGISIDAQFNESLKGISRDESLRRILQHGGKegDFNSQERAQLAYRKNLL 81 589********************************************************9999**************** PP TIGR01990 78 YvellkeltpedvlpgikelleelkkkkikialasasknaklvleklelkdkfdaivdaaevkkgkPdPeiFlaaaekl 156 Yv+ l+elt ++vlpgi++ll++l++++i+++las+s na+++l++lel++ f++++da+++k++kPdPeiFlaa++ l lcl|FitnessBrowser__Keio:15437 82 YVHSLRELTVNAVLPGIRSLLADLRAQQISVGLASVSLNAPTILAALELREFFTFCADASQLKNSKPDPEIFLAACAGL 160 ******************************************************************************* PP TIGR01990 157 gvspeecigieDaeaGieaikaagilavgvg 187 gv p++cigieDa+aGi+ai+a+g+ +vg+g lcl|FitnessBrowser__Keio:15437 161 GVPPQACIGIEDAQAGIDAINASGMRSVGIG 191 *****************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (187 nodes) Target sequences: 1 (219 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 17.46 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory