Align Trehalose/maltose transport system permease protein MalF (characterized)
to candidate 18061 b4033 maltose transporter subunit (NCBI)
Query= SwissProt::O51924 (295 letters) >FitnessBrowser__Keio:18061 Length = 514 Score = 134 bits (336), Expect = 6e-36 Identities = 93/256 (36%), Positives = 142/256 (55%), Gaps = 19/256 (7%) Query: 58 GLRNYLRVLS---AREFWYSTFV-TVSFSFVSVSLETILGLSFALILN-ERLKGRGVLRA 112 G +N+ RV + ++ + + FV TV FS ++V L +G+ A ++ E L+G+ V R Sbjct: 260 GWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRV 319 Query: 113 IVLIPWAVPTIISARTWELMYNYSYGLFNWILSIL-GVSPVNWLGTPISAFFAIVIADVW 171 ++++P+AVP+ IS ++ ++N S+G N +LS L GV P W P +A ++I + W Sbjct: 320 LLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPA-WFSDPTTARTMLIIVNTW 378 Query: 172 KTTPFMTLLLLAGLQAIPQDLYEAALIDGASMFERFKSITLPLLKPVLIVALILRTIDAL 231 P+M +L + L+AIP DLYEA+ +DGA F+ F ITLPLL L +I Sbjct: 379 LGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNF 438 Query: 232 RVFDIIYVLTGGGPG--GATTSISL--LAFNY-YNLG-------DYGIGSAISILTFVLV 279 F +I +LT GGP G TT L NY Y + D+G+ +AI+ L F+LV Sbjct: 439 NNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGGGQDFGLAAAIATLIFLLV 498 Query: 280 LSFTIVYLKVGRFRRD 295 + IV LK R + D Sbjct: 499 GALAIVNLKATRMKFD 514 Lambda K H 0.329 0.145 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 400 Number of extensions: 23 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 514 Length adjustment: 30 Effective length of query: 265 Effective length of database: 484 Effective search space: 128260 Effective search space used: 128260 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory