Align Trehalose transport system permease protein SugB (characterized)
to candidate 18060 b4032 maltose transporter subunit (NCBI)
Query= SwissProt::P9WG01 (274 letters) >FitnessBrowser__Keio:18060 Length = 296 Score = 124 bits (310), Expect = 3e-33 Identities = 86/280 (30%), Positives = 141/280 (50%), Gaps = 25/280 (8%) Query: 15 LVVGYALLPVLWIFSLSLKPTSTVKDGKLIPSTVTFDNYRGIFRGDLFSSA--------- 65 L + + P+L + ++SL+ G LIP +++D+++ + G A Sbjct: 22 LFIAAIMFPLLMVVAISLRQ-GNFATGSLIPEQISWDHWK-LALGFSVEQADGRITPPPF 79 Query: 66 -----LINSIGIGLITTVIAVVLGAMAAYAVARLEFPGKRLLIGAALLITMFPSISLVTP 120 L NS+ + I+ + V L AYA AR+ FPGK L+ L+ MFP++ + Sbjct: 80 PVLLWLWNSVKVAGISAIGIVALSTTCAYAFARMRFPGKATLLKGMLIFQMFPAVLSLVA 139 Query: 121 LFNIERAIGLF------DTWPGLILPYITFALPLAIYTLSAFFREIPWDLEKAAKMDGAT 174 L+ + +G + +T G+I Y+ + L ++T+ +F I LE+AA +DGAT Sbjct: 140 LYALFDRLGEYIPFIGLNTHGGVIFAYLG-GIALHVWTIKGYFETIDSSLEEAAALDGAT 198 Query: 175 PGQAFRKVIVPLAAPGLVTAAILVFIFAWNDLLLALSLTATKAAITAPVAIANFTGSSQF 234 P QAFR V++PL+ P L IL FI A ++ +A L + T V + + + Sbjct: 199 PWQAFRLVLLPLSVPILAVVFILSFIAAITEVPVASLLLRDVNSYTLAVGMQQYLNPQNY 258 Query: 235 EEPTGSIAAGAIVITIPIIVFVLIFQRRIVAGLTSGAVKG 274 G AA A++ +PI + L+ QR +V GLT+G VKG Sbjct: 259 --LWGDFAAAAVMSALPITIVFLLAQRWLVNGLTAGGVKG 296 Lambda K H 0.327 0.141 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 242 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 274 Length of database: 296 Length adjustment: 26 Effective length of query: 248 Effective length of database: 270 Effective search space: 66960 Effective search space used: 66960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory