Align acetaldehyde dehydrogenase; EC 1.2.1.10 (characterized)
to candidate 14489 b0351 acetaldehyde dehydrogenase (NCBI)
Query= CharProtDB::CH_002283 (316 letters) >lcl|FitnessBrowser__Keio:14489 b0351 acetaldehyde dehydrogenase (NCBI) Length = 316 Score = 612 bits (1579), Expect = e-180 Identities = 316/316 (100%), Positives = 316/316 (100%) Query: 1 MSKRKVAIIGSGNIGTDLMIKILRHGQHLEMAVMVGIDPQSDGLARARRMGVATTHEGVI 60 MSKRKVAIIGSGNIGTDLMIKILRHGQHLEMAVMVGIDPQSDGLARARRMGVATTHEGVI Sbjct: 1 MSKRKVAIIGSGNIGTDLMIKILRHGQHLEMAVMVGIDPQSDGLARARRMGVATTHEGVI 60 Query: 61 GLMNMPEFADIDIVFDATSAGAHVKNDAALREAKPDIRLIDLTPAAIGPYCVPVVNLEAN 120 GLMNMPEFADIDIVFDATSAGAHVKNDAALREAKPDIRLIDLTPAAIGPYCVPVVNLEAN Sbjct: 61 GLMNMPEFADIDIVFDATSAGAHVKNDAALREAKPDIRLIDLTPAAIGPYCVPVVNLEAN 120 Query: 121 VDQLNVNMVTCGGQATIPMVAAVSRVARVHYAEIIASIASKSAGPGTRANIDEFTETTSR 180 VDQLNVNMVTCGGQATIPMVAAVSRVARVHYAEIIASIASKSAGPGTRANIDEFTETTSR Sbjct: 121 VDQLNVNMVTCGGQATIPMVAAVSRVARVHYAEIIASIASKSAGPGTRANIDEFTETTSR 180 Query: 181 AIEVVGGAAKGKAIIVLNPAEPPLMMRDTVYVLSDEASQDDIEASINEMAEAVQAYVPGY 240 AIEVVGGAAKGKAIIVLNPAEPPLMMRDTVYVLSDEASQDDIEASINEMAEAVQAYVPGY Sbjct: 181 AIEVVGGAAKGKAIIVLNPAEPPLMMRDTVYVLSDEASQDDIEASINEMAEAVQAYVPGY 240 Query: 241 RLKQRVQFEVIPQDKPVNLPGVGQFSGLKTAVWLEVEGAAHYLPAYAGNLDIMTSSALAT 300 RLKQRVQFEVIPQDKPVNLPGVGQFSGLKTAVWLEVEGAAHYLPAYAGNLDIMTSSALAT Sbjct: 241 RLKQRVQFEVIPQDKPVNLPGVGQFSGLKTAVWLEVEGAAHYLPAYAGNLDIMTSSALAT 300 Query: 301 AEKMAQSLARKAGEAA 316 AEKMAQSLARKAGEAA Sbjct: 301 AEKMAQSLARKAGEAA 316 Lambda K H 0.317 0.132 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 451 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 316 Length of database: 316 Length adjustment: 27 Effective length of query: 289 Effective length of database: 289 Effective search space: 83521 Effective search space used: 83521 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate 14489 b0351 (acetaldehyde dehydrogenase (NCBI))
to HMM TIGR03215 (acetaldehyde dehydrogenase (acetylating) (EC 1.2.1.10))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03215.hmm # target sequence database: /tmp/gapView.12659.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03215 [M=285] Accession: TIGR03215 Description: ac_ald_DH_ac: acetaldehyde dehydrogenase (acetylating) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-146 471.5 5.4 5.2e-146 471.3 5.4 1.0 1 lcl|FitnessBrowser__Keio:14489 b0351 acetaldehyde dehydrogenase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Keio:14489 b0351 acetaldehyde dehydrogenase (NCBI) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 471.3 5.4 5.2e-146 5.2e-146 1 283 [. 3 308 .. 3 310 .. 0.98 Alignments for each domain: == domain 1 score: 471.3 bits; conditional E-value: 5.2e-146 TIGR03215 1 kvkvaiiGsGnigtdllikllr.sevlelallvGidpesdGlararelgvetsaeGvdalleee...didivfdatsak 75 k kvaiiGsGnigtdl+ik+lr +++le+a++vGidp+sdGlarar++gv+t++eGv +l++++ didivfdatsa lcl|FitnessBrowser__Keio:14489 3 KRKVAIIGSGNIGTDLMIKILRhGQHLEMAVMVGIDPQSDGLARARRMGVATTHEGVIGLMNMPefaDIDIVFDATSAG 81 679*******************99***************************************99999*********** PP TIGR03215 76 ahaenaklleel..gkividltPaavGpyvvPavnleevldaknvnlvtCgGqatiPivaavsrvakvkyaeivasias 152 ah++n+++l+e+ ++++idltPaa+Gpy+vP+vnle+++d+ nvn+vtCgGqatiP+vaavsrva+v+yaei+asias lcl|FitnessBrowser__Keio:14489 82 AHVKNDAALREAkpDIRLIDLTPAAIGPYCVPVVNLEANVDQLNVNMVTCGGQATIPMVAAVSRVARVHYAEIIASIAS 160 *********9987789*************************************************************** PP TIGR03215 153 ksaGpgtranideftettskaleqvgGakkgkaiiilnPaePpllmrdtvyalveeadeeaieasveemveevqkyvpG 231 ksaGpgtranideftetts+a+e vgGa+kgkaii+lnPaePpl+mrdtvy+l++ea++++ieas++em e+vq+yvpG lcl|FitnessBrowser__Keio:14489 161 KSAGPGTRANIDEFTETTSRAIEVVGGAAKGKAIIVLNPAEPPLMMRDTVYVLSDEASQDDIEASINEMAEAVQAYVPG 239 ******************************************************************************* PP TIGR03215 232 yrlkqevvld.................gekvsvlleveGagdylPkyaGnldiltaaalavaeklaeel 283 yrlkq+v+++ g k++v+leveGa++ylP+yaGnldi+t++ala+aek+a++l lcl|FitnessBrowser__Keio:14489 240 YRLKQRVQFEvipqdkpvnlpgvgqfsGLKTAVWLEVEGAAHYLPAYAGNLDIMTSSALATAEKMAQSL 308 ******************************************************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (285 nodes) Target sequences: 1 (316 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.01 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory