Align Anthranilate 1,2-dioxygenase (deaminating, decarboxylating) (EC 1.14.12.1) (characterized)
to candidate 15920 b1802 predicted 2Fe-2S cluster-containing protein (NCBI)
Query= reanno::pseudo13_GW456_L13:PfGW456L13_2740 (461 letters) >FitnessBrowser__Keio:15920 Length = 374 Score = 115 bits (287), Expect = 3e-30 Identities = 81/262 (30%), Positives = 124/262 (47%), Gaps = 9/262 (3%) Query: 34 FTEPELFDLEMELIFEKNWIYACHESEIANPNDFLTMRAGRQPMIITRDGNNQLHALINA 93 +T+ F+ E E +F K+WI H SE+AN ND++T + +++ R + L A N Sbjct: 29 YTDQNAFEHEKENVFAKSWICVAHSSELANANDYVTREIIGESIVLVRGRDKVLRAFYNV 88 Query: 94 CQHRGATLTRVSKGNQSTFTCPFHAWCYKSDGRLVKVKAPGEYPEGFDKATRGLKKARIE 153 C HRG L ++ TCP+HAW +K DG L + E FD L R+E Sbjct: 89 CPHRGHQLLSGEGKAKNVITCPYHAWAFKLDGNLAHAR-NCENVANFDSDKAQLVPVRLE 147 Query: 154 SYKGFVFISLDVNGSDSLEDYLG--DAKVFFDMMVAQSPTGELEILPGKSTYSYDGNWKL 211 Y GFVFI++D N + S+ED L AKV + A +L+ L + T NWK Sbjct: 148 EYAGFVFINMDPNAT-SVEDQLPGLGAKV----LEACPEVHDLK-LAARFTTRTPANWKN 201 Query: 212 QHENGLDGYHVSTVHYNYVSTVQHRQQVNAANGGVSDTLDYSKLGAGDAETDDGWFSFKN 271 +N L+ YH H + +VQ + + +G + ++K + ++G + + Sbjct: 202 IVDNYLECYHCGPAHPGFSDSVQVDRYWHTMHGNWTLQYGFAKPSEQSFKFEEGTDAAFH 261 Query: 272 GHSLLFSDMPNPTVRAGYATVM 293 G L M N T G TV+ Sbjct: 262 GFWLWPCTMLNVTPIKGMMTVI 283 Lambda K H 0.318 0.135 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 454 Number of extensions: 31 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 461 Length of database: 374 Length adjustment: 31 Effective length of query: 430 Effective length of database: 343 Effective search space: 147490 Effective search space used: 147490 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory