Align Aromatic amino acid:H+ symporter, AroP of 457 aas and 12 TMSs (Cosgriff and Pittard 1997). Transports phenylalanine, tyrosine and tryptophan (characterized)
to candidate 14540 b0402 predicted cryptic proline transporter (NCBI)
Query= TCDB::P15993 (457 letters) >FitnessBrowser__Keio:14540 Length = 457 Score = 386 bits (991), Expect = e-112 Identities = 195/447 (43%), Positives = 285/447 (63%), Gaps = 11/447 (2%) Query: 10 QLKRGLKNRHIQLIALGGAIGTGLFLGSASVIQSAGPGIILGYAIAGFIAFLIMRQLGEM 69 +LKRGL RHI+ +ALG AIGTGLF GSA I+ AGP ++L Y I G A++IMR LGEM Sbjct: 6 KLKRGLSTRHIRFMALGSAIGTGLFYGSADAIKMAGPSVLLAYIIGGIAAYIIMRALGEM 65 Query: 70 VVEEPVAGSFSHFAYKYWGSFAGFASGWNYWVLYVLVAMAELTAVGKYIQFWYPEIPTWV 129 V P A SFS +A + G AG+ +GW Y ++VA+A++TA G Y+ W+P +P W+ Sbjct: 66 SVHNPAASSFSRYAQENLGPLAGYITGWTYCFEILIVAIADVTAFGIYMGVWFPTVPHWI 125 Query: 130 SAAVFFVVINAINLTNVKVFGEMEFWFAIIKVIAVVAMIIFGGWLLF--SGNGGPQATVS 187 ++I A+NL +VKVFGE+EFWF+ KV ++ MI+ G ++ GNGG + Sbjct: 126 WVLSVVLIICAVNLMSVKVFGELEFWFSFFKVATIIIMIVAGFGIIIWGIGNGGQPTGIH 185 Query: 188 NLWDQGGFLPHGFTGLVMMMAIIMFSFGGLELVGITAAEADNPEQSIPKATNQVIYRILI 247 NLW GGF +G+ G+VM + ++MF++GG+E++GITA EA +PE+SIP+A N V RIL+ Sbjct: 186 NLWSNGGFFSNGWLGMVMSLQMVMFAYGGIEIIGITAGEAKDPEKSIPRAINSVPMRILV 245 Query: 248 FYIGSLAVLLSLMPWTRVTADTSPFVLIFHELGDTFVANALNIVVLTAALSVYNSCVYCN 307 FY+G+L V++S+ PW +V SPFVL F +G TF A+ LN VVLTA+LS NS V+ Sbjct: 246 FYVGTLFVIMSIYPWNQVGTAGSPFVLTFQHMGITFAASILNFVVLTASLSAINSDVFGV 305 Query: 308 SRMLFGLAQQGNAPKALASVDKRGVPVNTILVSALVTALCVLINYLAPESAFGLLMALVV 367 RML G+A+QG+APK + +RG+P T+LV V +NY+ PE+ F ++ +L Sbjct: 306 GRMLHGMAEQGSAPKIFSKTSRRGIPWVTVLVMTTALLFAVYLNYIMPENVFLVIASLAT 365 Query: 368 SALVINWAMISLAHMKFRRAKQEQGVVTRFPALLYPLGNWIC-----LLFMAAVLVIMLM 422 A V W MI L+ + FRR + V AL + + + L+F+ ++ ++ Sbjct: 366 FATVWVWIMILLSQIAFRRRLPPEEV----KALKFKVPGGVATTIGGLIFLLFIIGLIGY 421 Query: 423 TPGMAISVYLIPVWLIVLGIGYLFKEK 449 P IS+Y+ W++VL IG++FK + Sbjct: 422 HPDTRISLYVGFAWIVVLLIGWMFKRR 448 Lambda K H 0.328 0.141 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 648 Number of extensions: 42 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 457 Length of database: 457 Length adjustment: 33 Effective length of query: 424 Effective length of database: 424 Effective search space: 179776 Effective search space used: 179776 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory