Align Aromatic amino acid transport protein AroP (characterized, see rationale)
to candidate 1937132 b3795 predicted transporter (NCBI)
Query= uniprot:Q4KIP0 (466 letters) >FitnessBrowser__Keio:1937132 Length = 461 Score = 387 bits (993), Expect = e-112 Identities = 193/448 (43%), Positives = 289/448 (64%), Gaps = 13/448 (2%) Query: 9 ELKRGLKNRHIQLIALGGAIGTGLFLGSAGVLKSAGPSMILGYAIAGFIAFLIMRQLGEM 68 EL+RGL+ RHI+LIALGG IG GLF+G+A LK AGPS++L Y IAG F IMR +GEM Sbjct: 7 ELQRGLEARHIELIALGGTIGVGLFMGAASTLKWAGPSVLLAYIIAGLFVFFIMRSMGEM 66 Query: 69 IVEEPVAGSFSHFAHKYWGGYFGFLAGWNYWVLYVLVGMAELTAVGKYVQFWWPEIPTWV 128 + EPV GSF+ +AH+Y +FG+L W+YW +++ VG++E+TA+G YVQFW+PE+ W+ Sbjct: 67 LFLEPVTGSFAVYAHRYMSPFFGYLTAWSYWFMWMAVGISEITAIGVYVQFWFPEMAQWI 126 Query: 129 SAAVFFVLVNLINMMNVKFFGEAEFWFAIIKVVAIVGMIVLGCYMLF--SGSGGSQASVS 186 A + LV L N+ V+ +GE EFWFA+IKV I+ MIV+G ++F G+GG S Sbjct: 127 PALIAVALVALANLAAVRLYGEIEFWFAMIKVTTIIVMIVIGLGVIFFGFGNGGQSIGFS 186 Query: 187 NLWSHGGFFPNGGTGLLMAMAFIMFSFGGLELVGITAAEAAEPRKVIPKAINQVVYRVLI 246 NL HGGFF G G L A+ ++ S+ G+EL+GITA EA P+ + A+ +V++R+LI Sbjct: 187 NLTEHGGFFAGGWKGFLTALCIVVASYQGVELIGITAGEAKNPQVTLRSAVGKVLWRILI 246 Query: 247 FYVGALAVLLSLYPWDELLVSLNAGGDAYSSSPFVKIFSLIGSDAAAQILNFVVLTAALS 306 FYVGA+ V+++++PW+E+ + SPFV F+ IG AAA I+NFVVLTAALS Sbjct: 247 FYVGAIFVIVTIFPWNEI---------GSNGSPFVLTFAKIGITAAAGIINFVVLTAALS 297 Query: 307 VYNSGVYCNSRMLYGLAEQGDAPKALMKLNKQGVPILALGISALITLLCVLVNYLAPHEA 366 NSG+Y RMLY LA+ P A+ K+++ GVP+ + +S I L+ +NY+ P+ Sbjct: 298 GCNSGMYSCGRMLYALAKNRQLPAAMAKVSRHGVPVAGVAVSIAILLIGSCLNYIIPNPQ 357 Query: 367 LELLFALVVAAL--MINWALISLTHLRFRKAMAEQGVVPSFKAFWSPLSNYLCLAFMVMI 424 ++ + L M+ W +I ++ LRFR+A F++ P +NY+ +AF++ + Sbjct: 358 RVFVYVYSASVLPGMVPWFVILISQLRFRRAHKAAIASHPFRSILFPWANYVTMAFLICV 417 Query: 425 VGVMWMIPGIRASVYAIPVWVLVIWGFY 452 + M+ R S++ +++L + Y Sbjct: 418 LIGMYFNEDTRMSLFVGIIFMLAVTAIY 445 Lambda K H 0.327 0.141 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 698 Number of extensions: 40 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 466 Length of database: 461 Length adjustment: 33 Effective length of query: 433 Effective length of database: 428 Effective search space: 185324 Effective search space used: 185324 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory