Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate 17517 b3456 leucine/isoleucine/valine transporter subunit (NCBI)
Query= uniprot:A0A165KER0 (358 letters) >FitnessBrowser__Keio:17517 Length = 425 Score = 236 bits (603), Expect = 6e-67 Identities = 146/347 (42%), Positives = 200/347 (57%), Gaps = 46/347 (13%) Query: 13 VALLVLPLILQSF-GNAWVRIADLALLYVLLALGLNIVVGYAGLLDLGYVAFYAVGAYLF 71 VALLVL + V IA L ++Y++L LGLN+VVG +GLL LGY FYA+GAY F Sbjct: 94 VALLVLAVAWPFMVSRGTVDIATLTMIYIILGLGLNVVVGLSGLLVLGYGGFYAIGAYTF 153 Query: 72 ALMASPHLADNFAAFAAMFPNGLHTSLWIVIPVAALLAAFFGAMLGAPTLKLRGDYLAIV 131 AL+ + GL W +P+A L+AA G +LG P L+LRGDYLAIV Sbjct: 154 ALLNHYY--------------GL--GFWTCLPIAGLMAAAAGFLLGFPVLRLRGDYLAIV 197 Query: 132 TLGFGEIIRIFLNNLDHPVNLTNGPKGLGQIDSVKVFGLDLGKRLEVFGFDINS------ 185 TLGFGEI+RI L N +T GP G+ QI +FGL+ + G+D S Sbjct: 198 TLGFGEIVRILLLN---NTEITGGPNGISQIPKPTLFGLEFSRTAREGGWDTFSNFFGLK 254 Query: 186 ------VTLYYYLFLVLVVVSVIICYRLQDSRIGRAWMAIREDEIAAKAMGINTRNMKLL 239 V Y + L+LVV+S+ + RL +GRAW A+REDEIA +++G++ R +KL Sbjct: 255 YDPSDRVIFLYLVALLLVVLSLFVINRLLRMPLGRAWEALREDEIACRSLGLSPRRIKLT 314 Query: 240 AFGMGASFGGVSGAMFGAFQGFVSPESFSLMESVMIVAMVVLGGIGHIPGVILGAVLLSA 299 AF + A+F G +G +F A QGFVSPESF+ ES ++A+VVLGG+G VIL A+LL Sbjct: 315 AFTISAAFAGFAGTLFAARQGFVSPESFTFAESAFVLAIVVLGGMGSQFAVILAAILLVV 374 Query: 300 LPEVLRYVAGPLQAMTDGRLDSAILRQLLIALAMIIIMLLRPRGLWP 346 E++R D L++ M+++M+ RP+GL P Sbjct: 375 SRELMR--------------DFNEYSMLMLGGLMVLMMIWRPQGLLP 407 Lambda K H 0.328 0.144 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 362 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 425 Length adjustment: 31 Effective length of query: 327 Effective length of database: 394 Effective search space: 128838 Effective search space used: 128838 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory