Align 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 (characterized)
to candidate 14646 b0509 tartronate semialdehyde reductase, NADH-dependent (NCBI)
Query= SwissProt::P31937 (336 letters) >FitnessBrowser__Keio:14646 Length = 292 Score = 142 bits (358), Expect = 1e-38 Identities = 93/291 (31%), Positives = 140/291 (48%), Gaps = 12/291 (4%) Query: 42 VGFIGLGNMGNPMAKNLMKHGYPLIIYDVFPDACKEFQDAGEQVVSSPADVAEKADRIIT 101 +GFIGLG MG PMA NL + G+ L + + P A E G V + V E +D I Sbjct: 3 LGFIGLGIMGTPMAINLARAGHQLHVTTIGPVA-DELLSLGAVSVETARQVTEASDIIFI 61 Query: 102 MLPTSINAIEAYSGANGILKKVKKGSLLIDSSTIDPAVSKELAKEVEKMGAVFMDAPVSG 161 M+P + E G NG K KG ++D S+I P +K A++V ++G ++DAPVSG Sbjct: 62 MVPDTPQVEEVLFGENGCTKASLKGKTIVDMSSISPIETKRFARQVNELGGDYLDAPVSG 121 Query: 162 GVGAARSGNLTFMVGGVEDEFAAAQELLGCMGSNVVYCGAVGTGQAAKICNNMLLAISMI 221 G AR G L+ MVGG E F + L +G N+ G G GQ K+ N +++A+++ Sbjct: 122 GEIGAREGTLSIMVGGDEAVFERVKPLFELLGKNITLVGGNGDGQTCKVANQIIVALNIE 181 Query: 222 GTAEAMNLGIRLGLDPKLLAKIL--NMSSGRCWSSDTYNPVPGVMDGVPSANNYQGGFGT 279 +EA+ + G DP + + L +S R + + GF Sbjct: 182 AVSEALLFASKAGADPVRVRQALMGGFASSRILEVHGERMI---------KRTFNPGFKI 232 Query: 280 TLMAKDLGLAQDSATSTKSPILLGSLAHQIYRMMCAKGYSKKDFSSVFQFL 330 L KDL LA SA + + + +++ A G S+ D S++ Q L Sbjct: 233 ALHQKDLNLALQSAKALALNLPNTATCQELFNTCAANGGSQLDHSALVQAL 283 Lambda K H 0.318 0.133 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 215 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 292 Length adjustment: 27 Effective length of query: 309 Effective length of database: 265 Effective search space: 81885 Effective search space used: 81885 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory