Align ABC transporter permease; SubName: Full=Monosaccharide ABC transporter membrane protein, CUT2 family; SubName: Full=Sugar ABC transporter permease (characterized, see rationale)
to candidate 18114 b4086 D-allose transporter subunit (NCBI)
Query= uniprot:A0A1N7UKA9 (325 letters) >FitnessBrowser__Keio:18114 Length = 326 Score = 218 bits (556), Expect = 1e-61 Identities = 124/300 (41%), Positives = 180/300 (60%), Gaps = 6/300 (2%) Query: 23 DRFGLPLVFILLCVVMAFSS---EYFMTWRNWMDILRQTSINGILAVGMTYVILTKGIDL 79 D++G FIL +V F S EYF+T N I Q+S+ ++ +G + IL GIDL Sbjct: 24 DKYGT--FFILAIIVAIFGSLSPEYFLTTNNITQIFVQSSVTVLIGMGEFFAILVAGIDL 81 Query: 80 SVGSILAFAGLCSAMVATQGYG-LLAAVSAGMFAGAMLGVVNGFMVANLSIPPFVATLGM 138 SVG+ILA +G+ +A + G LAA+ G+ G LG +NG +V + PF+ TLG Sbjct: 82 SVGAILALSGMVTAKLMLAGVDPFLAAMIGGVLVGGALGAINGCLVNWTGLHPFIITLGT 141 Query: 139 LSIARGMTFILNDGSPITDLPDAYLALGIGKIGPIGVPIIIFAVVALIFWMVLRYTTYGR 198 +I RG+T +++D + + ++ + I VP+I +VALI W + GR Sbjct: 142 NAIFRGITLVISDANSVYGFSFDFVNFFAASVIGIPVPVIFSLIVALILWFLTTRMRLGR 201 Query: 199 YVYAVGGNEKSARTSGIGVRKVMFSVYVVSGLLAGLAGVVLSARTTSALPQAGVSYELDA 258 +YA+GGN+ SA SGI V+ + V+++SG+ AGLAGVV +AR +A P AG+ +E A Sbjct: 202 NIYALGGNKNSAFYSGIDVKFHILVVFIISGVCAGLAGVVSTARLGAAEPLAGMGFETYA 261 Query: 259 IAAVVIGGTSLSGGTGSIVGTLFGALLIGVINNGLNLLGVSSYYQQVAKGLIIVFAVLID 318 IA+ +IGGTS GG G I + G L+IG INNGLN+L V +YYQ V G +I+ AV +D Sbjct: 262 IASAIIGGTSFFGGKGRIFSVVIGGLIIGTINNGLNILQVQTYYQLVVMGGLIIAAVALD 321 Lambda K H 0.326 0.141 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 239 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 326 Length adjustment: 28 Effective length of query: 297 Effective length of database: 298 Effective search space: 88506 Effective search space used: 88506 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory