Align Lmo2663 protein (characterized, see rationale)
to candidate 18382 b4358 predicted oxidoreductase, Zn-dependent and NAD(P)-binding (RefSeq)
Query= uniprot:Q8Y414 (343 letters) >FitnessBrowser__Keio:18382 Length = 340 Score = 146 bits (368), Expect = 9e-40 Identities = 106/319 (33%), Positives = 156/319 (48%), Gaps = 6/319 (1%) Query: 17 KDVEEPQVYGDKVKIKVAFTGICGSDIHTFKGEYKNPTTPVTLGHEFSGVVVEVGPDVTS 76 K E P ++ IK+ GICG+DIH + G + P LGHE G +V +G ++ Sbjct: 18 KQREIPIPGDNEALIKIKSVGICGTDIHAWGGNQPFFSYPRVLGHEICGEIVGLGKNIAD 77 Query: 77 IKVGDRVTSETTFETCGECIYCKEHDYNLCSNRRGIGTQANGSFAEFVLSREESCHVLDE 136 +K G +V + + C +C CK N C IG +G F+E+ LS + + + Sbjct: 78 LKNGQQV-AVIPYVACQQCPACKSGRTNCCEKISVIGVHQDGGFSEY-LSVPVANILPAD 135 Query: 137 RISLEAAALTEPLACCVHSALEKTTIRPDDTVLVFGPGPIGLLLAQVVKAQGATVIMAGI 196 I +AAAL EP A H A+ + I P + VLV G GPIGL A + KA GA V++A Sbjct: 136 GIDPQAAALIEPFAISAH-AVRRAAIAPGEQVLVVGAGPIGLGAAAIAKADGAQVVVAD- 193 Query: 197 TKDSDRLRLAKELGMDRIVDTLKEDLAEVVLGMTGGYGAERVFDCSGAVPAVNQGLPLTK 256 T + R +A L + ++D ED + GG A++V D +G A+N + L + Sbjct: 194 TSPARREHVATRLELP-LLDPSAEDFDAQLRAQFGGSLAQKVIDATGNQHAMNNTVNLIR 252 Query: 257 KKGDFVQVGLFAEKKNAIDEESIIQREIAYIGSRSQKPSSWILALDLLANGKIDTDKMIT 316 G V VGLF + D E ++E +GSR+ P + L+A GKI D M+T Sbjct: 253 HGGTVVFVGLFKGELQFSDPE-FHKKETTMMGSRNATPEDFAKVGRLMAEGKITADMMLT 311 Query: 317 KVYGLDDWREAFEAVMAGN 335 Y E +E + N Sbjct: 312 HRYPFATLAETYERDVINN 330 Lambda K H 0.317 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 246 Number of extensions: 14 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 343 Length of database: 340 Length adjustment: 29 Effective length of query: 314 Effective length of database: 311 Effective search space: 97654 Effective search space used: 97654 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory