Align glyoxylate reductase (EC 1.1.1.26); 4-hydroxybutyrate dehydrogenase (EC 1.1.1.61); glyoxylate reductase (NADP+) (EC 1.1.1.79) (characterized)
to candidate 14646 b0509 tartronate semialdehyde reductase, NADH-dependent (NCBI)
Query= BRENDA::Q9LSV0 (289 letters) >FitnessBrowser__Keio:14646 Length = 292 Score = 140 bits (353), Expect = 3e-38 Identities = 88/286 (30%), Positives = 148/286 (51%), Gaps = 3/286 (1%) Query: 1 MEVGFLGLGIMGKAMSMNLLKNGFKVTVWNRTLSK-CDELVEHGASVCESPAEVIKKCKY 59 M++GF+GLGIMG M++NL + G ++ V T+ DEL+ GA E+ +V + Sbjct: 1 MKLGFIGLGIMGTPMAINLARAGHQLHV--TTIGPVADELLSLGAVSVETARQVTEASDI 58 Query: 60 TIAMLSDPCAALSVVFDKGGVLEQICEGKGYIDMSTVDAETSLKINEAITGKGGRFVEGP 119 M+ D V+F + G + +GK +DMS++ + + + GG +++ P Sbjct: 59 IFIMVPDTPQVEEVLFGENGCTKASLKGKTIVDMSSISPIETKRFARQVNELGGDYLDAP 118 Query: 120 VSGSKKPAEDGQLIILAAGDKALFEESIPAFDVLGKRSFYLGQVGNGAKMKLIVNMIMGS 179 VSG + A +G L I+ GD+A+FE P F++LGK +G G+G K+ +I+ Sbjct: 119 VSGGEIGAREGTLSIMVGGDEAVFERVKPLFELLGKNITLVGGNGDGQTCKVANQIIVAL 178 Query: 180 MMNAFSEGLVLADKSGLSSDTLLDILDLGAMTNPMFKGKGPSMNKSSYPPAFPLKHQQKD 239 + A SE L+ A K+G + L G ++ + + G M K ++ P F + QKD Sbjct: 179 NIEAVSEALLFASKAGADPVRVRQALMGGFASSRILEVHGERMIKRTFNPGFKIALHQKD 238 Query: 240 MRLALALGDENAVSMPVAAAANEAFKKARSLGLGDLDFSAVIEAVK 285 + LAL A+++P A E F + G LD SA+++A++ Sbjct: 239 LNLALQSAKALALNLPNTATCQELFNTCAANGGSQLDHSALVQALE 284 Lambda K H 0.317 0.134 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 179 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 292 Length adjustment: 26 Effective length of query: 263 Effective length of database: 266 Effective search space: 69958 Effective search space used: 69958 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory