Align D-xylose 1-dehydrogenase (EC 1.1.1.175) (characterized)
to candidate 15215 b1093 3-oxoacyl-[acyl-carrier-protein] reductase (NCBI)
Query= reanno::Korea:Ga0059261_1894 (259 letters) >FitnessBrowser__Keio:15215 Length = 244 Score = 115 bits (287), Expect = 1e-30 Identities = 79/244 (32%), Positives = 128/244 (52%), Gaps = 6/244 (2%) Query: 15 SLKGKRVLVTGGGSGIGAGIVEGFARQGADVTFFDIAGAESQLLVERLSADGHKACFERV 74 + +GK LVTG GIG I E A +GA V + +Q + + L A+G + Sbjct: 2 NFEGKIALVTGASRGIGRAIAETLAARGAKVIGTATSENGAQAISDYLGANGKGLM---L 58 Query: 75 DLTDVASLQAVIARLIKGAGGFDILVNNAANDDRHAIDEITEAYWDERLSVNLKHIFFCA 134 ++TD AS+++V+ ++ G DILVNNA + + + + W++ + NL +F + Sbjct: 59 NVTDPASIESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLS 118 Query: 135 QAVVPAMRARGGGAIVNLGSISWHLGLSDLVLYQTCKAAIEGLTRSLARDLGRDGIRATC 194 +AV+ AM + G I+ +GS+ +G Y KA + G ++SLAR++ GI Sbjct: 119 KAVMRAMMKKRHGRIITIGSVVGTMGNGGQANYAAAKAGLIGFSKSLAREVASRGITVNV 178 Query: 195 VIPGNVRTPRQLKWYSPEGEAEIVAAQCLDGRL-APEDVAAMVLFLASDDARLVTGHSYF 253 V PG + T + S + A I+ AQ GRL +++A V FLASD+A +TG + Sbjct: 179 VAPGFIETD-MTRALSDDQRAGIL-AQVPAGRLGGAQEIANAVAFLASDEAAYITGETLH 236 Query: 254 VDAG 257 V+ G Sbjct: 237 VNGG 240 Lambda K H 0.321 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 119 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 244 Length adjustment: 24 Effective length of query: 235 Effective length of database: 220 Effective search space: 51700 Effective search space used: 51700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory