Align D-xylose reductase (EC 1.1.1.307) (characterized)
to candidate 15889 b1771 predicted oxidoreductase (NCBI)
Query= BRENDA::F2YCN5 (340 letters) >FitnessBrowser__Keio:15889 Length = 326 Score = 181 bits (458), Expect = 3e-50 Identities = 111/314 (35%), Positives = 170/314 (54%), Gaps = 17/314 (5%) Query: 13 KISIKGIDKSATRVALGTWAIGGW-MWGGT-DDDASIKTIHRAIDLGINIIDTAPAYGRG 70 KI + D + +R+ LGTWAIGG W G D I TI A GIN+IDTAP Y G Sbjct: 3 KIPLGTTDITLSRMGLGTWAIGGGPAWNGDLDRQICIDTILEAHRCGINLIDTAPGYNFG 62 Query: 71 HAEEVVGKAIKG-QRDNLIIATKVGLDW-------TLTPDQSMRRNSSASRIKKEIEDSL 122 ++E +VG+A+K R+ +++ TK G+ W D+ + +N S I++E+ SL Sbjct: 63 NSEVIVGQALKKLPREQVVVETKCGIVWERKGSLFNKVGDRQLYKNLSPESIREEVAASL 122 Query: 123 RRLGTDYIDLYQVHW---PDPLVPIEETATILEALRKEGKIRSIGVSNYSVQQMDEFKKY 179 +RLG DYID+Y HW P PI ET +L L+ EGKIR+IG +N + E+ +Y Sbjct: 123 QRLGIDYIDIYMTHWQSVPPFFTPIAETVAVLNELKSEGKIRAIGAANVDADHIREYLQY 182 Query: 180 AELAVSQSPYNLFEREIDKDILPYAKKNDLVVLGYGALCRGLLSGRMTADRAFTGDDLRK 239 EL + Q+ Y++ +R ++ ++LP + N +VV Y L +GLL+G +T D + R Sbjct: 183 GELDIIQAKYSILDRAMENELLPLCRDNGIVVQVYSPLEQGLLTGTITRD--YVPGGARA 240 Query: 240 TDPKFQKPRFEHYLAAVEELKKLAKEHYNKSVLALAIRWMLEQGPTLA-LWGACKPEQID 298 FQ+ + +E+ + L Y ++ LA+ W+L+Q ++ L GA PEQ+ Sbjct: 241 NKVWFQRENMLKVIDMLEQWQPLC-ARYQCTIPTLALAWILKQSDLISILSGATAPEQVR 299 Query: 299 GIDEVFGWQISDED 312 +SD D Sbjct: 300 ENVAALNINLSDAD 313 Lambda K H 0.317 0.136 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 248 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 340 Length of database: 326 Length adjustment: 28 Effective length of query: 312 Effective length of database: 298 Effective search space: 92976 Effective search space used: 92976 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory