GapMind for catabolism of small carbon sources

 

Protein Ga0059261_0341 in Sphingomonas koreensis DSMZ 15582

Annotation: Ga0059261_0341 ABC-type antimicrobial peptide transport system, ATPase component

Length: 224 amino acids

Source: Korea in FitnessBrowser

Candidate for 21 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-histidine catabolism BPHYT_RS24015 lo ABC transporter related (characterized, see rationale) 40% 87% 147.1 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 203.0
L-arginine catabolism artP lo Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 38% 90% 146.4 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 203.0
L-histidine catabolism hisP lo Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 38% 90% 146.4 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 203.0
L-lysine catabolism hisP lo Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 38% 90% 146.4 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 203.0
D-glucosamine (chitosamine) catabolism AO353_21725 lo ABC transporter for D-Glucosamine, putative ATPase component (characterized) 36% 87% 135.6 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 203.0
L-asparagine catabolism bgtA lo ATPase (characterized, see rationale) 38% 83% 133.7 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 203.0
L-aspartate catabolism bgtA lo ATPase (characterized, see rationale) 38% 83% 133.7 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 203.0
D-maltose catabolism malK_Bb lo ABC-type maltose transport, ATP binding protein (characterized, see rationale) 35% 61% 129 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 203.0
L-citrulline catabolism PS417_17605 lo ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale) 33% 85% 127.1 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 203.0
D-cellobiose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 34% 60% 124.4 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 203.0
D-glucose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 34% 60% 124.4 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 203.0
lactose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 34% 60% 124.4 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 203.0
D-maltose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 34% 60% 124.4 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 203.0
sucrose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 34% 60% 124.4 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 203.0
trehalose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 34% 60% 124.4 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 203.0
N-acetyl-D-glucosamine catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 36% 60% 120.9 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 203.0
D-glucosamine (chitosamine) catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 36% 60% 120.9 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 203.0
D-sorbitol (glucitol) catabolism mtlK lo ABC transporter for D-Sorbitol, ATPase component (characterized) 34% 60% 118.6 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 203.0
L-fucose catabolism SM_b21106 lo ABC transporter for L-Fucose, ATPase component (characterized) 36% 57% 115.9 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 203.0
xylitol catabolism HSERO_RS17020 lo ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 35% 52% 112.1 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 203.0
trehalose catabolism treV lo TreV, component of Trehalose porter (characterized) 32% 62% 105.1 lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- 48% 203.0

Sequence Analysis Tools

View Ga0059261_0341 at FitnessBrowser

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Predict protein localization: PSORTb (Gram negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the SEED with FIGfam search

Fitness BLAST: loading...

Sequence

MSEPVLQTSGLKRTFSQGGADIHVLRGIDLTVGQGEIVALLGPSGSGKSTLLQAVGLLEG
GFEGSIRISGVEVGKLESHARTVTRRDKLGFVYQFHHLLPDFNALENVELPQLIQNATLA
DARARSEGLLTALGLGARLTHRPSQLSGGEQQRVAVARALANRPALVLADEPTGNLDEHT
ADIVLAEFLRLVRGEGAAALIATHNERLAAKMDRVVRLHEGVLE

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory