Align BadI (characterized)
to candidate Ga0059261_3685 Ga0059261_3685 Enoyl-CoA hydratase/carnithine racemase
Query= metacyc::MONOMER-892 (260 letters) >FitnessBrowser__Korea:Ga0059261_3685 Length = 257 Score = 100 bits (249), Expect = 3e-26 Identities = 79/257 (30%), Positives = 121/257 (47%), Gaps = 13/257 (5%) Query: 1 MQFEDLIYEIRNGVAWIIINRPDKMNAFRGTTCDELIKALYKAGYDKDVGAIVLAGAGDR 60 M +E ++ E V + +NRP +NA EL+ A K D G VL G+ ++ Sbjct: 1 MNYETILVEQHGAVTLVTLNRPQALNALNSQVLTELLDAFAKFDADPSQGCAVLTGS-EK 59 Query: 61 AFCTGGD--QSTHDGNYDGRGTVGLPMEELHTAIRDVPKPVIARVQGYAIGGGNVLATIC 118 AF G D + G D G + T R KP+IA V G+A+GGG LA +C Sbjct: 60 AFAAGADIKEMQAQGFADMYGHNFFAGWDQFTRTR---KPIIAAVSGFALGGGCELAMMC 116 Query: 119 DLTICSEKAIFGQVGPKMGSVDPGY-GTAFLARVVGEKKAREIWYMCKRYSGKEAEAMGL 177 D + ++ A FGQ K+ +V PG G+ L R VG+ KA E+ + +EAE GL Sbjct: 117 DFILAADTAKFGQPEIKL-AVAPGMGGSQRLTRAVGKAKAMEMCLTGRMMGAEEAERAGL 175 Query: 178 ANLCVPHDELDAEVQKWGEELCERSPTALAIAKRSFNMDTAHQAGIAGMGMYALKLY--- 234 + VP +L + K + +P ++ K N A + +A + +L+ Sbjct: 176 VSRIVPAADLLDDALKTAAAIAGMAPLSVLANKEMVN--AAFETTLAQGVQFERRLFHGL 233 Query: 235 YDTDESREGVKALQEKR 251 + T + +EG+ A EKR Sbjct: 234 FGTADQKEGMAAFVEKR 250 Lambda K H 0.319 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 166 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 257 Length adjustment: 24 Effective length of query: 236 Effective length of database: 233 Effective search space: 54988 Effective search space used: 54988 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory