Align BadK (characterized)
to candidate Ga0059261_3986 Ga0059261_3986 Enoyl-CoA hydratase/carnithine racemase
Query= metacyc::MONOMER-943 (258 letters) >FitnessBrowser__Korea:Ga0059261_3986 Length = 259 Score = 142 bits (358), Expect = 7e-39 Identities = 92/260 (35%), Positives = 138/260 (53%), Gaps = 3/260 (1%) Query: 1 MSSNPILTETQGRVGIITLNRPDVLNALNDALMDALGGALLAFDADDGIGAIVIAGNTRA 60 MS +L + V + LNRPD LNA+ ++D + +LL D+G A+++ G RA Sbjct: 1 MSQETVLYDLTDGVATLRLNRPDRLNAVTGEMLDLIRASLLRA-VDEGARAVLLTGEGRA 59 Query: 61 FAAGADIASMAAWSYSDVYGSNFITRN--WETIRQIRKPVLAAVAGLAYGGGCELALACD 118 F +GAD+ D + N ET+ ++ PV+ AV G A G G +ALA D Sbjct: 60 FCSGADLVGRMDGKPIDPADNLEFHYNPLAETLSKLPIPVVTAVNGPAAGAGVGIALAGD 119 Query: 119 IVIAGRSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYGLVS 178 IV+ +SA L +GL+P G T + ++ G+AKA++M L ++A++A GLV+ Sbjct: 120 IVVMAKSAYLLLAFSNIGLVPDCGATWLVAKSAGRAKALEMALLGEKVSADDAKDAGLVA 179 Query: 179 RVVDDDRLRDETVALATTIAAFSAPALMALKESLNRAFESTLAEGILFERRELHARFASA 238 RV +DD L +A +AA AL ++ + A STL+E + E + A + Sbjct: 180 RVAEDDALLATAGGIAAKLAAKPTVALGLIRAQVKAALNSTLSETLSIEAQNQRAAGKTE 239 Query: 239 DAREGIQAFLEKRAPCFSHR 258 D REG+ AFL KRAP F R Sbjct: 240 DFREGVTAFLAKRAPEFRGR 259 Lambda K H 0.321 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 117 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 259 Length adjustment: 24 Effective length of query: 234 Effective length of database: 235 Effective search space: 54990 Effective search space used: 54990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory