Align protocatechuate 4,5-dioxygenase alpha chain (EC 1.13.11.8) (characterized)
to candidate Ga0059261_0528 Ga0059261_0528 protocatechuate 4,5-dioxygenase, alpha subunit
Query= metacyc::MONOMER-15116 (139 letters) >FitnessBrowser__Korea:Ga0059261_0528 Length = 136 Score = 182 bits (461), Expect = 2e-51 Identities = 88/126 (69%), Positives = 106/126 (84%) Query: 9 DVHAYLAEFDDIPGTRVFTAQRARKGYNLNQFAMSLMKAENRERFKADESAYLDEWNLTP 68 D+H+YLAEF+DIPGTRVFTA RAR+GY+LNQFAMSLMK ENR+R+KA+E AYLDEW L+ Sbjct: 6 DIHSYLAEFEDIPGTRVFTASRARQGYHLNQFAMSLMKPENRKRWKANERAYLDEWPLSD 65 Query: 69 AAKAAVLARDYNAMIDEGGNVYFLSKLFSTDGKSFQFAAGSMTGMTQEEYAQMMIDGGRS 128 A KAA+LARDYN ++D GGN+YFLSK+FSTDG SF A +MTG++ E+Y MM GGRS Sbjct: 66 AQKAALLARDYNTLLDLGGNIYFLSKVFSTDGLSFVQAVSTMTGVSVEDYQAMMKAGGRS 125 Query: 129 PAGVRS 134 P G RS Sbjct: 126 PEGNRS 131 Lambda K H 0.317 0.131 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 103 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 139 Length of database: 136 Length adjustment: 15 Effective length of query: 124 Effective length of database: 121 Effective search space: 15004 Effective search space used: 15004 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 42 (20.8 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory