GapMind for catabolism of small carbon sources

 

Alignments for a candidate for xylF in Sphingomonas koreensis DSMZ 15582

Align 2-hydroxymuconate semialdehyde hydrolase; HMSH; EC 3.7.1.9; 2-hydroxymuconic semialdehyde hydrolase (uncharacterized)
to candidate Ga0059261_3183 Ga0059261_3183 Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily)

Query= curated2:P19076
         (283 letters)



>FitnessBrowser__Korea:Ga0059261_3183
          Length = 305

 Score = 69.7 bits (169), Expect = 7e-17
 Identities = 45/128 (35%), Positives = 68/128 (53%), Gaps = 4/128 (3%)

Query: 3   APQNSPEIGREIIAAGIRTNLHDSGAGFPLMMIHGSGPGVTAWANWRLVMPELAKSRRVI 62
           A Q +P     +  AGI       G G PL+++HG    +  +A    ++P LA+ R+VI
Sbjct: 31  AAQPTPVRSGTVEVAGIAYYYEIRGQGEPLLLLHGGLGSIDMFAP---ILPALAEGRQVI 87

Query: 63  APDMLGFGYSERPADAQYNRDVWVDHAVGVLDALEIEQADLVGNSFGGGIALALAIRHPE 122
           A D+ G G +           +  D ++ +LD L  +Q D++G S G G+A  LA RHP+
Sbjct: 88  AVDLQGHGRTPLGTRPIAIEPMGSDMSI-LLDKLGYKQVDVMGYSMGAGVAFQLAARHPD 146

Query: 123 RVRRLVLM 130
           RVRRL L+
Sbjct: 147 RVRRLALV 154


Lambda     K      H
   0.323    0.137    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 228
Number of extensions: 10
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 283
Length of database: 305
Length adjustment: 26
Effective length of query: 257
Effective length of database: 279
Effective search space:    71703
Effective search space used:    71703
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 48 (23.1 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory