Align Leucine//isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale)
to candidate Ga0059261_2542 Ga0059261_2542 ABC-type (unclassified) transport system, ATPase component
Query= uniprot:G8ALJ1 (236 letters) >FitnessBrowser__Korea:Ga0059261_2542 Length = 258 Score = 122 bits (305), Expect = 9e-33 Identities = 74/236 (31%), Positives = 123/236 (52%), Gaps = 4/236 (1%) Query: 2 LKVSGVHTFYGAIEALKGVDIEIGAGEIVSLIGANGAGKSTLLMTICGSPRARMGRITFE 61 L V + Y L V + +G GE+V L+G NGAGK+T ++ G + GRI + Sbjct: 22 LAVVSIAKSYDKRVVLSDVSLSVGKGEVVGLLGPNGAGKTTCFYSVMGLVKPDAGRIMLD 81 Query: 62 GQDITQMPTYELVRLGIAQSPEGRRIFPRMSVLENLQMGSITAKPGSFAN--ELERVLTL 119 G DIT +P Y LG+ P+ IF ++V +N+ ++P A L+++L Sbjct: 82 GVDITPLPMYRRAILGLGYLPQETSIFRGLTVAKNISAVLELSEPDKSARAARLDQLLEE 141 Query: 120 FPRLKERISQRAGTMSGGEQQMLAIGRALMSQPRLLLLDEPSLGLAPLVVKQIFQAVKDI 179 F + R A +SGGE++ I RAL + P ++LLDEP G+ P+ + I VK++ Sbjct: 142 FGLTRLR-DAPAMALSGGERRRAEIARALAADPSIMLLDEPFAGIDPISIADIRDLVKEL 200 Query: 180 NREQKMTVFMVEQNAFHALKLAHRGYVMVNGKVTMSGTGAELLANEEVRSAYLEGG 235 + + + V + + N L + R ++ +G+V +G+ +L+A+ VR YL G Sbjct: 201 -KTRNIGVLITDHNVRETLDIVDRASIIYDGRVLFAGSPEDLVADANVRRLYLGEG 255 Lambda K H 0.320 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 120 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 258 Length adjustment: 24 Effective length of query: 212 Effective length of database: 234 Effective search space: 49608 Effective search space used: 49608 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory