GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nagF in Sphingomonas koreensis DSMZ 15582

Align N-Acetyl-D-Glucosamine phosphotransferase system transporter, component of N-acetyl glucosamine-specific PTS permease, GlcNAc IIBC/GlcNAc I-HPr-IIA (characterized)
to candidate Ga0059261_2514 Ga0059261_2514 phosphoenolpyruvate-protein phosphotransferase

Query= TCDB::Q9HXN5
         (842 letters)



>lcl|FitnessBrowser__Korea:Ga0059261_2514 Ga0059261_2514
           phosphoenolpyruvate-protein phosphotransferase
          Length = 759

 Score =  268 bits (685), Expect = 9e-76
 Identities = 181/530 (34%), Positives = 261/530 (49%), Gaps = 19/530 (3%)

Query: 324 ALQRVRDDVQGSLQQARLGGDENEAAIFSAHLALLEDPGLLDAADMLIDQGVGAAHAWHR 383
           A  ++R+ +     QA  GG      +   +     D G     +  ID G+ A  A  R
Sbjct: 226 AFDKMREQIDRMTSQAEFGGGGEHEEVLETYKMFAYDEGWSRRINEAIDSGLTAEAAIER 285

Query: 384 AIQAQCEILQALGNLLLAERANDLRDLEKRVLRVL---LGDTAPLRVPAGAIVAAREITP 440
             Q     ++ + + LL +R +DL DL  R+LR++   LG  A L +   +I+ AR + P
Sbjct: 286 VQQRTRMRMRQIDDPLLRDRMHDLEDLSNRLLRIVSGQLGTAAQLGLRQDSILIARNLGP 345

Query: 441 SDLAPLVDAGAAGLCMAEGGATSHVAILARSKGLPCLVALGAGLLELEEGRQVVLDAGQG 500
           ++L         G+ + EG  T+HV I+AR+ G+P L  +      + EG ++++D  + 
Sbjct: 346 AELLEYDRRRLKGVVLEEGSLTAHVTIVARAMGVPVLGRVKDIRRLIAEGDRLLVDVTED 405

Query: 501 RLELSPDARRLEQVALQVAQREEQRRRQQADAQREALTRDGRRIEIGANVASPREAAEAF 560
            L + P A   E    ++   +++R    A      +T DG R+ +  N     + A   
Sbjct: 406 TLIIRPTAAMDEAFEAKLLVTQKRRAAFAALKNEAPVTTDGHRLTVMVNAGLRDDVAALD 465

Query: 561 ANGADGVGLLRTEFLFLERRAAPDEEEQRNAYQEVLDAMGQRKVIIRTIDVGGDKHLDYL 620
             GADG+GL RTEF FL     P  + QR  Y++VLDA G R V  RT+D+GGDK L YL
Sbjct: 466 LTGADGIGLFRTEFQFLVSATLPQRDSQRRLYKDVLDAAGDRPVTFRTVDIGGDKALPYL 525

Query: 621 PLPV---EENPALGLRGIHLGQARPELLDQQLRALLRVEPLERCRILLPMVSE---VDEL 674
                  EENPA+G R + L   R  L+  Q RALL         ++ PMVSE    DE 
Sbjct: 526 DHDENGEEENPAMGWRALRLALDREGLMKVQARALLEAAAGRTLNVMFPMVSEPWEFDEA 585

Query: 675 RAIRRRLGELATQLGIERLP---ELGVMIEVPSAALLADQLAEHADFLSIGTNDLSQYAL 731
           R +           G  +LP     G M+EVP+ A + D L    DFLS+GTNDL+Q+  
Sbjct: 586 RTLFETQRAWLESRG-HKLPLHIRYGAMLEVPALAEVLDLLLPRLDFLSVGTNDLTQFLF 644

Query: 732 AMDRCHAGLADRIDALHPALLRLIAQTCAGAARHGRWVGVCGALASDPLATPVLVGLGVE 791
           A DR H  LA R D L P++LR + +  A AA     + VCG +   PL    L+GLG++
Sbjct: 645 AADRAHPKLAVRYDWLSPSILRFLRRVTAEAAEADVPLAVCGEMGGRPLEAMALIGLGID 704

Query: 792 ELSVGPNLVGEIKTRVRQLDAAECRRHAQALLDLGSARAVRD--ACLQHW 839
            LS+ P  VG IK  VR LD A+     + +LD    R  +D  A L+ W
Sbjct: 705 RLSITPAAVGPIKAMVRSLDRAKLIAAMRGMLD----RPPQDMRAALEQW 750


Lambda     K      H
   0.319    0.136    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1356
Number of extensions: 68
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 842
Length of database: 759
Length adjustment: 41
Effective length of query: 801
Effective length of database: 718
Effective search space:   575118
Effective search space used:   575118
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 55 (25.8 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory