Align Organic acid uptake porter, DctA of 444 aas and 8 - 10 putative TMSs (characterized)
to candidate Ga0059261_0617 Ga0059261_0617 Na+/H+-dicarboxylate symporters
Query= TCDB::Q848I3 (444 letters) >FitnessBrowser__Korea:Ga0059261_0617 Length = 445 Score = 471 bits (1213), Expect = e-137 Identities = 234/409 (57%), Positives = 304/409 (74%) Query: 8 YKSLYFQVIVAIAIGILLGHFYPQTGVALKPLGDGFIKLIKMVIAPIIFCTVVSGIAGMQ 67 Y LY QV+VAIA G+ +G+F+P G +LKPLGD FIKL+KM+IAP+IF T+V+GIAGM Sbjct: 19 YGQLYVQVLVAIAAGVSVGYFWPDAGASLKPLGDAFIKLVKMIIAPVIFLTLVTGIAGMT 78 Query: 68 NMKSVGKTGGYALLYFEIVSTIALLIGLVVVNVVQPGNGMHIDVSTLDASKVAAYVTAGK 127 +KSVG+ G A YF ST+AL++GL+V N VQPG GM++D ++LD V YV Sbjct: 79 ELKSVGRVAGKAFAYFLFFSTLALVVGLIVANTVQPGAGMNVDPASLDTGAVKDYVAKAH 138 Query: 128 DQSIVGFILNVIPNTIVGAFANGDILQVLMFSVIFGFALHRLGAYGKPVLDFIDRFAHVM 187 D SIVGF++ +IP T+V A +LQVL+ S++FG AL +G PV D +++ V+ Sbjct: 139 DSSIVGFLMAIIPTTLVSALTGESLLQVLLVSILFGIALSMVGEPAAPVRDLLEKTGLVV 198 Query: 188 FNIINMIMKLAPIGALGAMAFTIGAYGVGSLVQLGQLMICFYITCVLFVLVVLGAICRAH 247 F ++ ++M+ AP+GA GAMAFTIG YG+ SL L L+ FY+T +FV+VVLG + + Sbjct: 199 FKLVGILMRAAPVGAFGAMAFTIGKYGIESLANLAGLVATFYLTSAIFVVVVLGVVAKLA 258 Query: 248 GFSVLKLIRYIREELLIVLGTSSSESALPRMLIKMERLGAKKSVVGLVIPTGYSFNLDGT 307 GFS+ KLIRY+R ELL+VLGTSSSESALP ++ KMER G K VVGLV+PTGYSFNLDGT Sbjct: 259 GFSIFKLIRYLRAELLLVLGTSSSESALPSLMDKMERAGCAKPVVGLVVPTGYSFNLDGT 318 Query: 308 SIYLTMAAVFIAQATDTHMDITHQITLLLVLLLSSKGAAGVTGSGFIVLAATLSAVGHLP 367 +IY+T+AA+FIAQA + + + QI LL + ++SSKGAAGVTG+GFI LAATLS V +P Sbjct: 319 NIYMTLAALFIAQACNVDLSLGDQIALLAIAMISSKGAAGVTGAGFITLAATLSIVPDVP 378 Query: 368 VAGLALILGIDRFMSEARALTNLVGNAVATVVVAKWVKELDEDQLQAEL 416 VAG+ALILGIDRFMSE R+LTN +GNAVAT+VVA+W LD L L Sbjct: 379 VAGMALILGIDRFMSECRSLTNFIGNAVATIVVARWDNALDTAALHHAL 427 Lambda K H 0.326 0.142 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 558 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 444 Length of database: 445 Length adjustment: 32 Effective length of query: 412 Effective length of database: 413 Effective search space: 170156 Effective search space used: 170156 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory