Align Na+/glucose cotransporter (characterized, see rationale)
to candidate Ga0059261_1623 Ga0059261_1623 transporter, SSS family
Query= uniprot:Q8AAV7 (564 letters) >FitnessBrowser__Korea:Ga0059261_1623 Length = 549 Score = 259 bits (663), Expect = 1e-73 Identities = 181/594 (30%), Positives = 299/594 (50%), Gaps = 84/594 (14%) Query: 4 LDWLVIGVFFLALIGIIVWVVRQKQN---DSADYFLGGRDATWLAIGASIFASNIGSEHL 60 +D +V+ V+ + + + WV R+K D++DYFL + W AIGAS+ A+NI +E + Sbjct: 7 IDLIVVIVYAIGIFALAQWVSREKAGHAKDTSDYFLASKSLPWWAIGASLIAANISAEQI 66 Query: 61 IGLAGAGASSGMAMAHWEIQGWM----ILILGWVFVPFYSRSMVYTMPEFLERRYNPQSR 116 +G++G+G + G+A+A +E WM +LI+G F+P + ++ +YTMP+FLE+R+ P R Sbjct: 67 VGMSGSGYAIGLAIASYE---WMAALTLLIVGKWFLPIFLKNEIYTMPQFLEQRFGPTIR 123 Query: 117 TILSVISLVSYVLTKVAVTVYAGGLVFQQVFGIKELWGIDFFWIAAIGLVVLTALYTIFG 176 T+++V L Y+ + ++ G + QV G+ + IA GL +Y + G Sbjct: 124 TVMAVFWLALYIFVNLTSILWLGSIAVTQVAGVDQ-------DIALFGLGAFALVYQLRG 176 Query: 177 GMKSVLYTSVLQTPILLLGSLIILVLGFKELGGWDEMMRVCGAVTVNDYGDTMTNLIRSN 236 G+K+V T ++Q +L+LG L+I L ++GG +M +T G L N Sbjct: 177 GLKAVALTDIVQVTLLVLGGLVISYLTLSKIGGDAGVMGGFTRLTTELPGKFDMILAPDN 236 Query: 237 D-DANFPWLGALIGSA-IIGFWYWCTDQFIVQRVLSGKNEKEARRGTIFGAYLKLLPVFL 294 + P L LIG I YW +Q+I+QR L+ K+ EA++G +F A+LKLL + Sbjct: 237 PFYKDLPGLSVLIGGMWIANLSYWGFNQYIIQRALAAKSLSEAQKGVVFAAFLKLLMPVI 296 Query: 295 FLIPGMIAFALHQKYIGAGGEGFLPMLANGTANADAAFPTLVAKLLPAGVKGLVVCGILA 354 ++PG+ A +LA A D A+PT++ +LLP G+ GLV ++A Sbjct: 297 IVLPGIAAV----------------ILAPDLAKPDQAYPTMM-RLLPVGLLGLVFAALVA 339 Query: 355 ALMSSLASLFNSSAMLFTIDFYKRFR--------------------PETPEKKLVGIGQI 394 A+++S AS NS A +FT+D Y + + EK+LV +G+ Sbjct: 340 AIIASTASKINSIATIFTLDLYAKAKGVQSRAQDAATASASGDSGLTAAHEKQLVRVGRT 399 Query: 395 ATVVIVILGILWI-PIMRSVGDVLYTYLQDVQSVLAPGIAAAFLLGICWKRTSAQGGMWG 453 VV +L I P++ S+ D + Y+Q+ + PGI FLLG+ W R + G + G Sbjct: 400 TAVVATLLAIFTARPLLGSL-DQAFQYIQEFSGFVTPGITVIFLLGLFWPRATEAGALTG 458 Query: 454 LIAGMIIGLTRLGAKVYYSNAGEVADSTFKYLFYDMNWLFFCGWMFLFCIIVVIVVSLAT 513 +A +++ +++ A +T + + MN + +F + + +VVSL Sbjct: 459 AVASVLLSF------LFWFPADWGGIATLNAVPF-MNRMMI---VFFVSLALAVVVSLVR 508 Query: 514 EAPTAEK---IQGLVFGTATKEQKAATRASWDHWDIIHTVIILAITGAFYWYFW 564 AP +QG+ FGT T A VII+ I A Y +W Sbjct: 509 PAPADSNRITMQGVSFGTTTSFNVAG-------------VIIIMILIALYATWW 549 Lambda K H 0.328 0.142 0.454 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 901 Number of extensions: 51 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 564 Length of database: 549 Length adjustment: 36 Effective length of query: 528 Effective length of database: 513 Effective search space: 270864 Effective search space used: 270864 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory