GapMind for catabolism of small carbon sources

 

Aligments for a candidate for BT0355 in Sphingomonas koreensis DSMZ 15582

Align Na+/glucose cotransporter (characterized, see rationale)
to candidate Ga0059261_1623 Ga0059261_1623 transporter, SSS family

Query= uniprot:Q8AAV7
         (564 letters)



>lcl|FitnessBrowser__Korea:Ga0059261_1623 Ga0059261_1623
           transporter, SSS family
          Length = 549

 Score =  259 bits (663), Expect = 1e-73
 Identities = 181/594 (30%), Positives = 299/594 (50%), Gaps = 84/594 (14%)

Query: 4   LDWLVIGVFFLALIGIIVWVVRQKQN---DSADYFLGGRDATWLAIGASIFASNIGSEHL 60
           +D +V+ V+ + +  +  WV R+K     D++DYFL  +   W AIGAS+ A+NI +E +
Sbjct: 7   IDLIVVIVYAIGIFALAQWVSREKAGHAKDTSDYFLASKSLPWWAIGASLIAANISAEQI 66

Query: 61  IGLAGAGASSGMAMAHWEIQGWM----ILILGWVFVPFYSRSMVYTMPEFLERRYNPQSR 116
           +G++G+G + G+A+A +E   WM    +LI+G  F+P + ++ +YTMP+FLE+R+ P  R
Sbjct: 67  VGMSGSGYAIGLAIASYE---WMAALTLLIVGKWFLPIFLKNEIYTMPQFLEQRFGPTIR 123

Query: 117 TILSVISLVSYVLTKVAVTVYAGGLVFQQVFGIKELWGIDFFWIAAIGLVVLTALYTIFG 176
           T+++V  L  Y+   +   ++ G +   QV G+ +        IA  GL     +Y + G
Sbjct: 124 TVMAVFWLALYIFVNLTSILWLGSIAVTQVAGVDQ-------DIALFGLGAFALVYQLRG 176

Query: 177 GMKSVLYTSVLQTPILLLGSLIILVLGFKELGGWDEMMRVCGAVTVNDYGDTMTNLIRSN 236
           G+K+V  T ++Q  +L+LG L+I  L   ++GG   +M     +T    G     L   N
Sbjct: 177 GLKAVALTDIVQVTLLVLGGLVISYLTLSKIGGDAGVMGGFTRLTTELPGKFDMILAPDN 236

Query: 237 D-DANFPWLGALIGSA-IIGFWYWCTDQFIVQRVLSGKNEKEARRGTIFGAYLKLLPVFL 294
               + P L  LIG   I    YW  +Q+I+QR L+ K+  EA++G +F A+LKLL   +
Sbjct: 237 PFYKDLPGLSVLIGGMWIANLSYWGFNQYIIQRALAAKSLSEAQKGVVFAAFLKLLMPVI 296

Query: 295 FLIPGMIAFALHQKYIGAGGEGFLPMLANGTANADAAFPTLVAKLLPAGVKGLVVCGILA 354
            ++PG+ A                 +LA   A  D A+PT++ +LLP G+ GLV   ++A
Sbjct: 297 IVLPGIAAV----------------ILAPDLAKPDQAYPTMM-RLLPVGLLGLVFAALVA 339

Query: 355 ALMSSLASLFNSSAMLFTIDFYKRFR--------------------PETPEKKLVGIGQI 394
           A+++S AS  NS A +FT+D Y + +                        EK+LV +G+ 
Sbjct: 340 AIIASTASKINSIATIFTLDLYAKAKGVQSRAQDAATASASGDSGLTAAHEKQLVRVGRT 399

Query: 395 ATVVIVILGILWI-PIMRSVGDVLYTYLQDVQSVLAPGIAAAFLLGICWKRTSAQGGMWG 453
             VV  +L I    P++ S+ D  + Y+Q+    + PGI   FLLG+ W R +  G + G
Sbjct: 400 TAVVATLLAIFTARPLLGSL-DQAFQYIQEFSGFVTPGITVIFLLGLFWPRATEAGALTG 458

Query: 454 LIAGMIIGLTRLGAKVYYSNAGEVADSTFKYLFYDMNWLFFCGWMFLFCIIVVIVVSLAT 513
            +A +++        +++  A     +T   + + MN +     +F   + + +VVSL  
Sbjct: 459 AVASVLLSF------LFWFPADWGGIATLNAVPF-MNRMMI---VFFVSLALAVVVSLVR 508

Query: 514 EAPTAEK---IQGLVFGTATKEQKAATRASWDHWDIIHTVIILAITGAFYWYFW 564
            AP       +QG+ FGT T    A              VII+ I  A Y  +W
Sbjct: 509 PAPADSNRITMQGVSFGTTTSFNVAG-------------VIIIMILIALYATWW 549


Lambda     K      H
   0.328    0.142    0.454 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 901
Number of extensions: 51
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 564
Length of database: 549
Length adjustment: 36
Effective length of query: 528
Effective length of database: 513
Effective search space:   270864
Effective search space used:   270864
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory