Align Arabinose-proton symporter; Arabinose transporter (characterized)
to candidate Ga0059261_1891 Ga0059261_1891 MFS transporter, sugar porter (SP) family
Query= SwissProt::P96710 (464 letters) >FitnessBrowser__Korea:Ga0059261_1891 Length = 466 Score = 283 bits (723), Expect = 1e-80 Identities = 150/459 (32%), Positives = 250/459 (54%), Gaps = 19/459 (4%) Query: 19 SMGFVILISCAAGLGGLLYGYDTAVISGAIGFLKDLYSLSPFMEGLVISSIMIGGVVGVG 78 +MG ++ I A +GGLL+GYD+ ++G LK ++LS G + S++IG +G Sbjct: 8 NMGLIMAIVAVATIGGLLFGYDSGAVNGTQDGLKSAFALSEGGLGFTVGSLLIGCFIGAF 67 Query: 79 ISGFLSDRFGRRKILMTAALLFAISAIVSALSQDVSTLIIARIIGGLGIGMGSSLSVTYI 138 ++G L+D GRR +++ A+LF I A++ S + + ARI GG+ +G S LS YI Sbjct: 68 LAGRLADLIGRRNVMILTAVLFLIGALIQGFSHEQWIFVAARIAGGMAVGAASVLSPAYI 127 Query: 139 TEAAPPAIRGSLSSLYQLFTILGISATYFINLAVQR----SGTYEWGVHTGWRWMLAYGM 194 +E AP IRG ++++ Q+ I G++A + +N + + S WG + WRWM Sbjct: 128 SEVAPANIRGRMTTIQQIMIISGLTAAFVVNYWLAKTAGASTNLFWGGYEAWRWMYWMQA 187 Query: 195 VPSVIFFLVLLVVPESPRWLAKAGKTNEALKILTRINGETVAKEELKNIENSLKIEQMGS 254 +P+ +F + L +PESPR+L G+ EA ++LT + G A +L I+ S + + Sbjct: 188 IPATVFLIALFFIPESPRYLVSKGRNAEATRVLTSLFGAGTATNKLTEIQASFS-DHRPT 246 Query: 255 LSQLFKP---GLRKALVIGILLALFNQVIGMNAITYYGPEIFKMMGFGQNAGFVTTCIVG 311 L + P G+R + G+LLA+F Q++G+N I YYG ++++ GF +N + + G Sbjct: 247 LRDILDPVKGGVRPIVWAGLLLAVFQQLVGINVIFYYGATLWQLAGFTENDALLINIVSG 306 Query: 312 VVEVIFTVIAVLLIDKVGRKKLMSIGSAFMAIFMILIGTSF-----------YFELTSGI 360 V + + V L+D++GRK L+ IGSA MA+ + + +F GI Sbjct: 307 FVSIAACFVTVALVDRIGRKPLLLIGSAGMAVALFAMVFAFSRGSLDAQGKLVLSQQLGI 366 Query: 361 MMIVLILGFVAAFCVSVGPITWIMISEIFPNHLRARAAGIATIFLWGANWAIGQFVPMMI 420 + ++ +V F VS GP+ W+M+ E+FPN +R A + W +N+ I Q P+M Sbjct: 367 IAVIAANLYVVFFNVSWGPVMWVMLGEMFPNQIRGSALAVCGFAQWFSNYLIAQSFPIMA 426 Query: 421 DSFGLAYTFWIFAVINILCFLFVVTICPETKNKSLEEIE 459 GLA ++ +AV ++ F V ETK LE+++ Sbjct: 427 AGLGLAVSYSFYAVCAVISFFLVSKFIHETKGVELEDMQ 465 Lambda K H 0.327 0.142 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 544 Number of extensions: 29 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 464 Length of database: 466 Length adjustment: 33 Effective length of query: 431 Effective length of database: 433 Effective search space: 186623 Effective search space used: 186623 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory