Align L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate Ga0059261_2966 Ga0059261_2966 2-deoxy-D-gluconate 3-dehydrogenase
Query= reanno::pseudo6_N2E2:Pf6N2E2_5967 (272 letters) >FitnessBrowser__Korea:Ga0059261_2966 Length = 251 Score = 126 bits (317), Expect = 4e-34 Identities = 90/252 (35%), Positives = 126/252 (50%), Gaps = 16/252 (6%) Query: 19 LKNKVVLLTGAAQGIGEAIVAAFASQQARLVISDIQA--EKVETVAAHWRERGADVHALK 76 L +V ++TGA GIG+ I A A A + A E VE V R G + Sbjct: 7 LTGRVAVVTGANTGIGQGIALALAQAGADIAAVGRSAATETVEKV----RALGRKAEIVS 62 Query: 77 ADVSNQQDLHAMARHAVERHGRIDVLVNCAGVNVFRDPLEMTEEDWRRCFAIDLDGAWYG 136 AD+S + + + VE+ G +D+LVN AG+ D +E TEEDW +L ++ Sbjct: 63 ADLSTIEPVQRVVDETVEKLGGLDILVNNAGIIRRADSVEFTEEDWDAVMDTNLKSVFFL 122 Query: 137 CKAVLPQMIEQGVGSIINIAS--THSSHI-IPGCFPYPVAKHGLLGLTRALGIEYAPKGV 193 C+A MI G G IINIAS T I +P Y +K G+ GLT+ L E+A KG+ Sbjct: 123 CQAAARHMIANGGGKIINIASMLTFQGGIRVPS---YTASKSGVGGLTKLLANEWASKGI 179 Query: 194 RVNAIAPGYIETQLNVDYWNGFADPYAERQRALDLHPPRRIGQPIEVAMTAVFLASDEAP 253 VNAIAPGYI T N D ++ ++ P R G P ++ AVFLAS + Sbjct: 180 TVNAIAPGYIATN-NTD---ALQKDETRNRQIMERIPAGRWGDPADLGGAAVFLASRASD 235 Query: 254 FINASCITIDGG 265 ++ + +DGG Sbjct: 236 YVQGHILAVDGG 247 Lambda K H 0.321 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 251 Length adjustment: 25 Effective length of query: 247 Effective length of database: 226 Effective search space: 55822 Effective search space used: 55822 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory