Align ornithine carbamoyltransferase (EC 2.1.3.3) (characterized)
to candidate Ga0059261_3206 Ga0059261_3206 ornithine carbamoyltransferase
Query= BRENDA::Q98BB6 (303 letters) >FitnessBrowser__Korea:Ga0059261_3206 Length = 307 Score = 308 bits (789), Expect = 1e-88 Identities = 162/308 (52%), Positives = 203/308 (65%), Gaps = 10/308 (3%) Query: 1 MSVRHFTDLSTVSEGDLRFMLDDAVVRKARLKAGE------RTRPLEGKVLAMIFDKPST 54 M+ R+F LS + ML DA+ RK R +AG+ PL G+ LAM+F+K ST Sbjct: 1 MTYRNFLSLSDAGADGIAAMLADAIDRK-RARAGQPKGAVDADAPLAGRTLAMVFEKNST 59 Query: 55 RTRVSFDVGMRQLGGETIMLTGTEMQLGRSETIADTAKVLSRYVDAIMIRTTSHDRLLEL 114 RTRVSF++ +RQLGG ++L QLGR ET+ADTA+VLS Y DAIM+RT H +LLE+ Sbjct: 60 RTRVSFEMAIRQLGGSAVVLDAATSQLGRGETVADTARVLSGYCDAIMVRTDDHAKLLEM 119 Query: 115 TENATVPVINGLTDDTHPCQLMADIMTFEEHRGPVAGKTIAWTGDGNNVLHSLLEASARF 174 + ATVPVINGLTDD+HPCQ+MAD+ T E + G +AW GDGNNVL S++EA+ Sbjct: 120 AQYATVPVINGLTDDSHPCQIMADLQTILESGKALPGLKVAWLGDGNNVLASIVEAAGLM 179 Query: 175 RFNLNVAVPEGSEPAQKHIDWSKAHGGKLHFTRSPEEAVDQADCVVTDCWVSMGQEHRAR 234 F++ A P+ ++ + K G+ P EAV AD VVTD W+SMGQ H Sbjct: 180 HFDVVAACPQSFALPEEAMALGK---GRARTVNDPVEAVAGADVVVTDTWISMGQAHADV 236 Query: 235 GHNVFSPYQVNAKLMAHAKPDALFMHCLPAHRGEEVTDEVIDGPHSVVFDEAENRLHAQK 294 +PYQV LMA A PDA F+HCLPAHRGEEVTD VIDGP S+++ EAENRLHAQK Sbjct: 237 KLAALAPYQVTEALMAQASPDAKFLHCLPAHRGEEVTDAVIDGPQSLIWPEAENRLHAQK 296 Query: 295 AVLAWCLG 302 AVL WC G Sbjct: 297 AVLRWCFG 304 Lambda K H 0.320 0.133 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 321 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 303 Length of database: 307 Length adjustment: 27 Effective length of query: 276 Effective length of database: 280 Effective search space: 77280 Effective search space used: 77280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate Ga0059261_3206 Ga0059261_3206 (ornithine carbamoyltransferase)
to HMM TIGR00658 (argF: ornithine carbamoyltransferase (EC 2.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00658.hmm # target sequence database: /tmp/gapView.32493.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00658 [M=304] Accession: TIGR00658 Description: orni_carb_tr: ornithine carbamoyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-107 344.8 0.0 2.4e-107 344.6 0.0 1.0 1 lcl|FitnessBrowser__Korea:Ga0059261_3206 Ga0059261_3206 ornithine carbamo Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Korea:Ga0059261_3206 Ga0059261_3206 ornithine carbamoyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 344.6 0.0 2.4e-107 2.4e-107 1 303 [. 4 303 .. 4 304 .. 0.94 Alignments for each domain: == domain 1 score: 344.6 bits; conditional E-value: 2.4e-107 TIGR00658 1 rhllslldlseeelkellelakklkkekkkgke.....ekklkgktlaliFekrstRtRvsfevaayel 64 r++lsl d + + +l a + k+++ + + ++ l g+tla++Fek+stRtRvsfe+a+ +l lcl|FitnessBrowser__Korea:Ga0059261_3206 4 RNFLSLSDAGADGIAAMLADAIDRKRARAGQPKgavdaDAPLAGRTLAMVFEKNSTRTRVSFEMAIRQL 72 789*******************9999887655456677899**************************** PP TIGR00658 65 GaqvlylnkeelqlgrkesikDtarvlsryvdaivvRvykhedveelakyasvPvingLtdlehPcqil 133 G+ +++l++ +qlgr+e+++Dtarvls y dai+vR+ +h ++ e+a+ya+vPvingLtd +hPcqi+ lcl|FitnessBrowser__Korea:Ga0059261_3206 73 GGSAVVLDAATSQLGRGETVADTARVLSGYCDAIMVRTDDHAKLLEMAQYATVPVINGLTDDSHPCQIM 141 ********************************************************************* PP TIGR00658 134 aDlltikeklgklkevklvyvGDannvanslllaaaklGldvvvatPeglepeaeivkkakkiakengg 202 aDl+ti e ++l ++k++++GD+nnv s++ aa ++ +dvv a+P+ + +e + g lcl|FitnessBrowser__Korea:Ga0059261_3206 142 ADLQTILESGKALPGLKVAWLGDGNNVLASIVEAAGLMHFDVVAACPQSFALPEEAMAL-------GKG 203 ************************************************99766554433.......348 PP TIGR00658 203 kleltedpkkavkdadviytDvwvsmGeeekkeerlkllkpyqvneellelakpevkflhCLPavrGee 271 + + ++dp++av++adv++tD+w+smG+ ++ + +l++l pyqv+e l++ a p++kflhCLPa+rGee lcl|FitnessBrowser__Korea:Ga0059261_3206 204 RARTVNDPVEAVAGADVVVTDTWISMGQAHA-DVKLAALAPYQVTEALMAQASPDAKFLHCLPAHRGEE 271 9999***********************9765.59*********************************** PP TIGR00658 272 vtdevlegeasivfdeaenRlhaqkavlkall 303 vtd v++g++s+++ eaenRlhaqkavl +++ lcl|FitnessBrowser__Korea:Ga0059261_3206 272 VTDAVIDGPQSLIWPEAENRLHAQKAVLRWCF 303 ****************************9876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (307 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.02 # Mc/sec: 4.01 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory