Align ornithine carbamoyltransferase (EC 2.1.3.3) (characterized)
to candidate Ga0059261_3206 Ga0059261_3206 ornithine carbamoyltransferase
Query= BRENDA::Q98BB6 (303 letters) >FitnessBrowser__Korea:Ga0059261_3206 Length = 307 Score = 308 bits (789), Expect = 1e-88 Identities = 162/308 (52%), Positives = 203/308 (65%), Gaps = 10/308 (3%) Query: 1 MSVRHFTDLSTVSEGDLRFMLDDAVVRKARLKAGE------RTRPLEGKVLAMIFDKPST 54 M+ R+F LS + ML DA+ RK R +AG+ PL G+ LAM+F+K ST Sbjct: 1 MTYRNFLSLSDAGADGIAAMLADAIDRK-RARAGQPKGAVDADAPLAGRTLAMVFEKNST 59 Query: 55 RTRVSFDVGMRQLGGETIMLTGTEMQLGRSETIADTAKVLSRYVDAIMIRTTSHDRLLEL 114 RTRVSF++ +RQLGG ++L QLGR ET+ADTA+VLS Y DAIM+RT H +LLE+ Sbjct: 60 RTRVSFEMAIRQLGGSAVVLDAATSQLGRGETVADTARVLSGYCDAIMVRTDDHAKLLEM 119 Query: 115 TENATVPVINGLTDDTHPCQLMADIMTFEEHRGPVAGKTIAWTGDGNNVLHSLLEASARF 174 + ATVPVINGLTDD+HPCQ+MAD+ T E + G +AW GDGNNVL S++EA+ Sbjct: 120 AQYATVPVINGLTDDSHPCQIMADLQTILESGKALPGLKVAWLGDGNNVLASIVEAAGLM 179 Query: 175 RFNLNVAVPEGSEPAQKHIDWSKAHGGKLHFTRSPEEAVDQADCVVTDCWVSMGQEHRAR 234 F++ A P+ ++ + K G+ P EAV AD VVTD W+SMGQ H Sbjct: 180 HFDVVAACPQSFALPEEAMALGK---GRARTVNDPVEAVAGADVVVTDTWISMGQAHADV 236 Query: 235 GHNVFSPYQVNAKLMAHAKPDALFMHCLPAHRGEEVTDEVIDGPHSVVFDEAENRLHAQK 294 +PYQV LMA A PDA F+HCLPAHRGEEVTD VIDGP S+++ EAENRLHAQK Sbjct: 237 KLAALAPYQVTEALMAQASPDAKFLHCLPAHRGEEVTDAVIDGPQSLIWPEAENRLHAQK 296 Query: 295 AVLAWCLG 302 AVL WC G Sbjct: 297 AVLRWCFG 304 Lambda K H 0.320 0.133 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 321 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 303 Length of database: 307 Length adjustment: 27 Effective length of query: 276 Effective length of database: 280 Effective search space: 77280 Effective search space used: 77280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate Ga0059261_3206 Ga0059261_3206 (ornithine carbamoyltransferase)
to HMM TIGR00658 (argF: ornithine carbamoyltransferase (EC 2.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00658.hmm # target sequence database: /tmp/gapView.26907.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00658 [M=304] Accession: TIGR00658 Description: orni_carb_tr: ornithine carbamoyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-107 344.8 0.0 2.4e-107 344.6 0.0 1.0 1 lcl|FitnessBrowser__Korea:Ga0059261_3206 Ga0059261_3206 ornithine carbamo Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Korea:Ga0059261_3206 Ga0059261_3206 ornithine carbamoyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 344.6 0.0 2.4e-107 2.4e-107 1 303 [. 4 303 .. 4 304 .. 0.94 Alignments for each domain: == domain 1 score: 344.6 bits; conditional E-value: 2.4e-107 TIGR00658 1 rhllslldlseeelkellelakklkkekkkgke.....ekklkgktlaliFekrstRtRvsfevaayel 64 r++lsl d + + +l a + k+++ + + ++ l g+tla++Fek+stRtRvsfe+a+ +l lcl|FitnessBrowser__Korea:Ga0059261_3206 4 RNFLSLSDAGADGIAAMLADAIDRKRARAGQPKgavdaDAPLAGRTLAMVFEKNSTRTRVSFEMAIRQL 72 789*******************9999887655456677899**************************** PP TIGR00658 65 GaqvlylnkeelqlgrkesikDtarvlsryvdaivvRvykhedveelakyasvPvingLtdlehPcqil 133 G+ +++l++ +qlgr+e+++Dtarvls y dai+vR+ +h ++ e+a+ya+vPvingLtd +hPcqi+ lcl|FitnessBrowser__Korea:Ga0059261_3206 73 GGSAVVLDAATSQLGRGETVADTARVLSGYCDAIMVRTDDHAKLLEMAQYATVPVINGLTDDSHPCQIM 141 ********************************************************************* PP TIGR00658 134 aDlltikeklgklkevklvyvGDannvanslllaaaklGldvvvatPeglepeaeivkkakkiakengg 202 aDl+ti e ++l ++k++++GD+nnv s++ aa ++ +dvv a+P+ + +e + g lcl|FitnessBrowser__Korea:Ga0059261_3206 142 ADLQTILESGKALPGLKVAWLGDGNNVLASIVEAAGLMHFDVVAACPQSFALPEEAMAL-------GKG 203 ************************************************99766554433.......348 PP TIGR00658 203 kleltedpkkavkdadviytDvwvsmGeeekkeerlkllkpyqvneellelakpevkflhCLPavrGee 271 + + ++dp++av++adv++tD+w+smG+ ++ + +l++l pyqv+e l++ a p++kflhCLPa+rGee lcl|FitnessBrowser__Korea:Ga0059261_3206 204 RARTVNDPVEAVAGADVVVTDTWISMGQAHA-DVKLAALAPYQVTEALMAQASPDAKFLHCLPAHRGEE 271 9999***********************9765.59*********************************** PP TIGR00658 272 vtdevlegeasivfdeaenRlhaqkavlkall 303 vtd v++g++s+++ eaenRlhaqkavl +++ lcl|FitnessBrowser__Korea:Ga0059261_3206 272 VTDAVIDGPQSLIWPEAENRLHAQKAVLRWCF 303 ****************************9876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (307 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 10.34 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory