GapMind for catabolism of small carbon sources

 

Aligments for a candidate for astB in Sphingomonas koreensis DSMZ 15582

Align Succinylarginine dihydrolase (EC 3.5.3.23) (characterized)
to candidate Ga0059261_3995 Ga0059261_3995 succinylarginine dihydrolase (EC 3.5.3.23)

Query= reanno::MR1:201844
         (444 letters)



>lcl|FitnessBrowser__Korea:Ga0059261_3995 Ga0059261_3995
           succinylarginine dihydrolase (EC 3.5.3.23)
          Length = 418

 Score =  342 bits (876), Expect = 2e-98
 Identities = 200/440 (45%), Positives = 267/440 (60%), Gaps = 29/440 (6%)

Query: 1   MKHFEANFDGLVGPTHNYAGLSFGNVASLNNAALVSNPKAAAKQGLQKAKALADLGMIQG 60
           M   E NFDGL+GP+HNYAGLS GN+A+  N+  VS P+AAA QG+ K +A   LG+ QG
Sbjct: 1   MPRVEINFDGLIGPSHNYAGLSPGNLAATRNSGAVSQPRAAALQGIAKMRANLALGLTQG 60

Query: 61  MLAPQERPDLNTLRRIGFSGSDAQVLQQAAKTAPALLNACCSASSMWTANAATVSPSADT 120
           +L P  RPD   L  +  S +DA    QA            SASSMW ANAATVSP+ DT
Sbjct: 61  ILLPHARPDHRWLDSLATSYTDAAAHLQAQ---------ALSASSMWAANAATVSPAPDT 111

Query: 121 RDGKLHFTPANLVDKLHRSIE-PITTGRILTATFNDPHYFYHHNHLPEHNSFGDEGAANH 179
            DG+ H T ANLV   HRS E P T  ++  A  ND   F  H  +P    FGDEGAANH
Sbjct: 112 ADGRCHLTVANLVTMPHRSHEWPGTLAQLRLAFGNDA--FRVHGPVPA--PFGDEGAANH 167

Query: 180 TRLCQEYGHAGVELFVYGQEATNPHAPKPLKFPARQTLEASMAIARLHQLEEDNCVFIQQ 239
            RLC E+   GVE+FVYG             FPARQ  EAS A+AR H L+    +F+QQ
Sbjct: 168 MRLCPEHDAPGVEVFVYGVSGG--------PFPARQHREASEAVARRHGLDPARTLFVQQ 219

Query: 240 NPAVIDQGVFHNDVIAVGNQNVLFYHEQAFLNTQAKLDEIKRKLDTELYFIEVPTAKVSI 299
           + A I  G FHNDV+AV N  VLF HEQAF + Q    +++R +  E+  +EVP + VS+
Sbjct: 220 SEAAIAAGAFHNDVVAVANGRVLFAHEQAFADKQGFYADLRRVMP-EVEIVEVPASAVSL 278

Query: 300 NDAVKSYLFNTQIITLPSGEMAIIAPTDCQENPAVYAYLNELLSLNTPIKQVLYFDVKQS 359
            DA+ SYLFN Q++TLPSGE A++ PT+ ++ P+V+A+L   ++ N PI+ +   DV+QS
Sbjct: 279 ADAISSYLFNAQLVTLPSGETALVLPTEARDTPSVWAWLQAHVAGNGPIRHLEVVDVRQS 338

Query: 360 MQNGGGPACLRLRVAMNEREVAAVNQHTLLTDALFTRLNTWVEKHYRDRLSTEDLADPQL 419
           M NGGGPACLRLRV     + A ++   L+      R+   VE H+ + ++ +++ DP L
Sbjct: 339 MANGGGPACLRLRVV---ADPATIDPRFLVDPGKLDRIAALVEMHWPETIAQDEIGDPAL 395

Query: 420 VIE---SRTALDELTQIMKL 436
           +     +R AL +L  I++L
Sbjct: 396 IARIEAARAALLDLLGIVEL 415


Lambda     K      H
   0.318    0.132    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 462
Number of extensions: 14
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 444
Length of database: 418
Length adjustment: 32
Effective length of query: 412
Effective length of database: 386
Effective search space:   159032
Effective search space used:   159032
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory