GapMind for catabolism of small carbon sources

 

Aligments for a candidate for astC in Sphingomonas koreensis DSMZ 15582

Align Succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate Ga0059261_3205 Ga0059261_3205 transaminase, acetylornithine/succinylornithine family

Query= reanno::Koxy:BWI76_RS11670
         (406 letters)



>lcl|FitnessBrowser__Korea:Ga0059261_3205 Ga0059261_3205
           transaminase, acetylornithine/succinylornithine family
          Length = 398

 Score =  324 bits (830), Expect = 3e-93
 Identities = 173/393 (44%), Positives = 236/393 (60%), Gaps = 10/393 (2%)

Query: 14  MMPVYAPAAFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPRLVKALTEQAGKFWH 73
           +MPVY      PVRGEG  L  ++G+ Y+DFA GIAVNALGH HP+  KA+ EQA    H
Sbjct: 6   LMPVYPRCEVRPVRGEGCYLIGERGERYLDFAAGIAVNALGHGHPQFTKAIAEQAATLMH 65

Query: 74  TGNGYTNEPVLRLAKQLIDATFADRVFFCNSGAEANEAALKLARKYAHDRFGSEKSGIVA 133
             N Y +     LA++++D +FAD VFF NSG EA E A+K AR+Y +     ++  ++ 
Sbjct: 66  VSNLYGSPQGEALAQRIVDNSFADTVFFTNSGVEAIECAIKTARRYHYVNGNPQRHKLIT 125

Query: 134 FKNAFHGRTLFTVSAGGQPAYSQDFAPLPPQIQHAIYNDLDSAKALIDDNTCAVIVEPMQ 193
           FKNAFHGR++  +SA  QP     F PL P   +  +NDL+ A A IDD T   +VE +Q
Sbjct: 126 FKNAFHGRSIGAISATDQPKMRDGFEPLLPGFDYVKFNDLEGAIAKIDDETAGFLVETVQ 185

Query: 194 GEGGVVPADADFLRGLRELCDAHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLSTAKA 253
           GEGG+     +F++GLR+ CD H  LLI DE+Q G GRTG+++AY HYG+TPD+L+ AK 
Sbjct: 186 GEGGMTAGTVEFIQGLRKACDEHGLLLILDEIQCGYGRTGKMWAYEHYGITPDILTAAKG 245

Query: 254 LGGGFPIGALLASERCASVMTVGTHGTTYGGNPLACAVAGEVFATINTREVLNGVKQRHQ 313
           +G GFP+GA LA+E  A  MT GTHG+TYGGNPLA A AG+    +       G  +  +
Sbjct: 246 IGNGFPLGACLATEEAAKGMTFGTHGSTYGGNPLAMA-AGQAVLDVMLEP---GFFEHVE 301

Query: 314 WFCERLNA-----INARYGLFKEIRGLGLLIGCVLKDEYAGKAKAISNQAAEEGLMILIA 368
              ERL A     I     LF EIRG GL++G  LK E A     +++     GL+ + A
Sbjct: 302 KMGERLRAGFEQLIPNHDHLFDEIRGKGLMLGIKLK-EPAVSRDFVAHLRENHGLLTVAA 360

Query: 369 GANVVRFAPALIISEDEVNSGLDRFELACKRFL 401
           G NV R  P L+I E  +   +++     + ++
Sbjct: 361 GENVFRVLPPLVIEESHIAECIEKLSAGARSYV 393


Lambda     K      H
   0.321    0.137    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 469
Number of extensions: 20
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 406
Length of database: 398
Length adjustment: 31
Effective length of query: 375
Effective length of database: 367
Effective search space:   137625
Effective search space used:   137625
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory