Align succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate Ga0059261_4131 Ga0059261_4131 Ornithine/acetylornithine aminotransferase
Query= BRENDA::O30508 (406 letters) >FitnessBrowser__Korea:Ga0059261_4131 Length = 398 Score = 289 bits (740), Expect = 9e-83 Identities = 164/382 (42%), Positives = 221/382 (57%), Gaps = 10/382 (2%) Query: 22 APAAFIPVRGEGSRVWDQSGRE-LIDFAGGIAVTSLGHAHPALVKALTEQAQRIWHVSNV 80 AP AF RGEG+ ++ G E +D G+A +LGH HP LV AL QA ++WH+SN+ Sbjct: 12 APIAFD--RGEGAWLYPVDGGEPYLDCVAGVATNALGHCHPVLVAALEAQAAKLWHISNM 69 Query: 81 FTNEPALRLARKLVDATFAERVFLANSGAEANEAAFKLARRYANDVYGPQKYEIIAASNS 140 F LA +L A+FA+ VF NSG EA E A K+ARRY PQ+ +I S + Sbjct: 70 FEMPGQNALAERLTTASFADTVFFTNSGTEAVECAIKVARRYHAARGEPQRQTVIGFSGA 129 Query: 141 FHGRTLFTVNVGGQPKYSDGFGPKFEGITHVPYNDLEALKAAISDK-TCAVVLEPIQGEG 199 FHGRT +N G P + DGFG + G H ++ AL AI+D T AVV+EP+QGEG Sbjct: 130 FHGRTYGAMNAAGNPAHLDGFGDRLPGFVHFAVDNWPALALAIADSATAAVVVEPVQGEG 189 Query: 200 GVLPAQQAYLEGARKLCDEHNALLVFDEVQSGMGRVGELFAYMHY-GVVPDILSSAKSLG 258 G + +L+ R C H LL++DEVQ+GMGR G+LFA+ Y PDI++ AK+LG Sbjct: 190 GARAMTEPFLDKLRAACTAHGVLLIYDEVQTGMGRTGKLFAHQWYPDATPDIMALAKALG 249 Query: 259 GGFPIGAMLTTGEIAKHLSVGTHGTTYGGNPLASAVAEAALDVINTPEVLDGVKAKHERF 318 GFP+GA L T E A + G HGTT GGNPLA AVA AA D I PE L + + Sbjct: 250 SGFPVGACLATAEAASGMVPGVHGTTAGGNPLAMAVAIAAFDEIAKPETLTHAREVAQHL 309 Query: 319 KSRLQKIGQEY-GIFDEIRGMGLLIGAALTDEWKGKARDVLNAAEKEAVMVLQASPDVVR 377 ++ L ++ + G+ EIRG GLL+G L R + AA ++ ++V + VR Sbjct: 310 RAGLDRLAATHPGVISEIRGKGLLVGVRLVP----NNRAFMAAAREQRLLVAGGGDNCVR 365 Query: 378 FAPSLVIDDAEIDEGLERFERA 399 P L + AE D+ L+R + A Sbjct: 366 LLPPLTLTVAEADQILDRLDTA 387 Lambda K H 0.318 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 421 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 398 Length adjustment: 31 Effective length of query: 375 Effective length of database: 367 Effective search space: 137625 Effective search space used: 137625 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory