Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate Ga0059261_0484 Ga0059261_0484 ABC-type multidrug transport system, ATPase component
Query= uniprot:Q1MCU3 (247 letters) >FitnessBrowser__Korea:Ga0059261_0484 Length = 245 Score = 100 bits (250), Expect = 2e-26 Identities = 74/239 (30%), Positives = 116/239 (48%), Gaps = 5/239 (2%) Query: 9 QPLLQVNGVETYYGNIRALAGVDVHVNKGEIVSLIGANGAGKSTLMMTICGSPQARTGSV 68 Q + + V YG L G+ + V G I +L+G NGAGKST + + G +A++G++ Sbjct: 5 QASVLLQDVSLAYGAQEVLRGLTLSVPAGSITALLGGNGAGKSTTLAALLGFVRAQSGTI 64 Query: 69 VFEGRDITRMPTHEIARLRIAQSPEGRRIFPRMTVLENLQMGAGLDNLKHFAEDVEKIFT 128 + G D P + AR RIA PE ++ ++ EN + L +H D+ + F Sbjct: 65 LVCGVDPGSDP--DGARRRIAYLPENVALYEHLSATENAEYLLALSGEQHARRDITEAFA 122 Query: 129 LFPRLKERHAQRGGTLSGGEQQMLSIGRALMARPKLLLLDEPSLGLAPLIVKGIFEAIRK 188 +E QR G S G +Q ++I AL+ R +LLLDEP+ GL P F A+ Sbjct: 123 AAGLQEEAWDQRLGGFSKGMRQKVAIAVALLRRVPVLLLDEPTSGLDPRATAD-FNALVA 181 Query: 189 LNEAEGLTVFLVEQNAFAALRLSHRAYVMVNGKVT--MSGSGKELLANPEVRAAYLEGG 245 G V +V + +A ++ R + NG+VT ++ SG E + A + GG Sbjct: 182 QVRDRGTAVLMVTHDLLSAADVADRIAFLENGRVTDEVAASGPERFDVRALHARFQVGG 240 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 138 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 245 Length adjustment: 24 Effective length of query: 223 Effective length of database: 221 Effective search space: 49283 Effective search space used: 49283 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory