Align 3-hydroxybutyryl-CoA dehydratase; EC 4.2.1.55 (characterized)
to candidate Ga0059261_2840 Ga0059261_2840 Enoyl-CoA hydratase/carnithine racemase
Query= CharProtDB::CH_091794 (261 letters) >FitnessBrowser__Korea:Ga0059261_2840 Length = 263 Score = 140 bits (353), Expect = 3e-38 Identities = 85/247 (34%), Positives = 137/247 (55%), Gaps = 5/247 (2%) Query: 11 EGKVAVVTINRPKALNALNSDTLKEMDYVIGEIENDSEVLAVILTGAGEKSFVAGADISE 70 +G + + TINRP +NA++ + + + + ++ D E +ILTGAG ++F AGAD+ Sbjct: 10 DGGIVIATINRPARMNAIDRNLIASFEALFDRLDADREARVLILTGAG-RAFCAGADLKS 68 Query: 71 --MKEMNTIEGRKFGILGNKVFRRLELLEKPVIAAVNGFALGGGCEIAMSCDIRIASSNA 128 ++ E + ++ R+ L +PVIAAVNG A GGG ++ DIRIA +A Sbjct: 69 DFVESAGPEESLASQLRLARLMERIANLRQPVIAAVNGAAAGGGFAFTLAADIRIAGRSA 128 Query: 129 RFGQPEVGLGITPGFGGTQ-RLSRLVGMGMAKQLIFTAQNIKADEALRIGLVNKVVEPSE 187 F LG++ G G L RL+G+ A +L+ T + A+EA RIG V + V Sbjct: 129 HFSIANARLGLSAGECGISWLLPRLIGLSRAFELMLTGRKFDAEEAERIGYVVRTVADDV 188 Query: 188 LMNTAKEIANKIVSNAPVAVKLSKQAINRGMQ-CDIDTALAFESEAFGECFSTEDQKDAM 246 L++TA E A I +NAP V ++K + R ++ + A+A E+ C + D ++A+ Sbjct: 189 LLDTALETARLIAANAPFGVAMTKDVVRRNLETASMQAAIALEARTQLLCGGSGDFREAV 248 Query: 247 TAFIEKR 253 +AF+EKR Sbjct: 249 SAFLEKR 255 Lambda K H 0.317 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 150 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 263 Length adjustment: 25 Effective length of query: 236 Effective length of database: 238 Effective search space: 56168 Effective search space used: 56168 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory