Align Putative 4-guanidinobutyryl amide hydrolase (characterized, see rationale)
to candidate Ga0059261_3603 Ga0059261_3603 Predicted amidohydrolase
Query= uniprot:A0A291T3M3 (267 letters) >FitnessBrowser__Korea:Ga0059261_3603 Length = 275 Score = 90.5 bits (223), Expect = 3e-23 Identities = 83/259 (32%), Positives = 117/259 (45%), Gaps = 26/259 (10%) Query: 14 DVDANLHELDAACRRARAEGAELLVTTELFITGYDIGDTVRDLARTDL--------LTPA 65 D AN L +A A GA +L T E+ + D R+ A ++ L Sbjct: 13 DALANAATLADGVAKASAGGAAMLFTPEMS----GLLDRQRERAAANIVLESEDRVLAAV 68 Query: 66 RQMAASHGIALVLGAPEYDS---GAYYNSAFFIDPAGTVLGRHRKNHLF------GELDR 116 R+ AA HG+ + LG+ G + N F ID +G + R+ K HLF GE R Sbjct: 69 REAAAKHGVWVHLGSLALKGEADGRFVNRGFVIDGSGEIRARYDKLHLFDVDLPTGERWR 128 Query: 117 RY--FTPGDRTAPVIDYGGVRIAMLICYDVEFPENVRAAALAGADLVAVPTAQMRPYEFI 174 + PG +A V+ ++ + ICYD+ FP+ RA AGA L+AVP A RP Sbjct: 129 ESDAYAPG-ASAAVVGTPLGKLGLAICYDLRFPDLFRALTDAGATLLAVPAAFTRPTGQA 187 Query: 175 AEH-LLRVRAWENQIYIAYVNHDGD-EGSQRYVGRSSIVSPSATVLDSVEHGNRLLFATV 232 H LLR RA E +++ G+ E + G S + P VL + G L FA + Sbjct: 188 HWHVLLRARAIEAGVHVIAAAQTGEHEDGRATYGHSVAIDPWGEVLLDMGEGAGLGFAEI 247 Query: 233 DPYTVREARKANPYLADLR 251 DP V + R P +A R Sbjct: 248 DPARVADVRSRVPAIAHRR 266 Lambda K H 0.320 0.137 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 162 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 275 Length adjustment: 25 Effective length of query: 242 Effective length of database: 250 Effective search space: 60500 Effective search space used: 60500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory