Align beta-aspartyl-peptidase (EC 3.4.19.5); asparaginase (EC 3.5.1.1) (characterized)
to candidate Ga0059261_1159 Ga0059261_1159 Asparaginase
Query= BRENDA::P37595 (321 letters) >FitnessBrowser__Korea:Ga0059261_1159 Length = 639 Score = 270 bits (689), Expect = 9e-77 Identities = 150/309 (48%), Positives = 197/309 (63%), Gaps = 8/309 (2%) Query: 6 IAIHGGAGAISRAQMSLQQELRYIEALSAIVETGQKMLEAGESALDVVTEAVRLLEECPL 65 +AIHGGAG I R ++ +E Y L+ + G +L+ G ALD V AVR+LE+ PL Sbjct: 334 LAIHGGAGVIERGTLTPAKEAAYRAGLAEALRAGGAVLDRGGPALDAVAAAVRILEDNPL 393 Query: 66 FNAGIGAVFTRDETHELDACVMDGNTLKAGAVAGVSHLRNPVLAARLVMEQSPHVMMIGE 125 FNAG GAVFT + +ELDA +MDG T KAGAVAGV+ R+P+ AR VM+++ HVM+ + Sbjct: 394 FNAGRGAVFTAEGRNELDAAIMDGATQKAGAVAGVTRTRHPIDLARAVMDKTRHVMLARD 453 Query: 126 GAENFAFARGMERVSPEIFSTSLRYEQLLAARKEGATVLDHSGAPLDEKQKMGTVGAVAL 185 GA+ F+ +G+E+V+PE F T R++QL A R + A +D S GTVGAVAL Sbjct: 454 GADRFSIEQGLEQVAPEWFRTEERWQQLQAWRNKQAGAVDRS-------HLFGTVGAVAL 506 Query: 186 DLDGNLAAATSTGGMTNKLPGRVGDSPLVGAGCYANNASVAVSCTGTGEVFIRALAAYDI 245 D DGNLAAATSTGGMT K GRVGDSP++GAG YA N AVS TG+GE FIR AA + Sbjct: 507 DADGNLAAATSTGGMTGKRWGRVGDSPIIGAGTYAKNGQCAVSATGSGEYFIRESAARQV 566 Query: 246 AALMDYGGLSLAEACERVVMEKLPALGGSGGLIAIDHEGNVALPFNTEGMYRAWGYAGDT 305 + + G +LA A + +M + ++GG GGLIA+ G A N GMYR G Sbjct: 567 CDRVAWNGETLANAAQATIM-AVGSIGGDGGLIAMGSNGKPAFAINDLGMYRGRIGPGSE 625 Query: 306 PTTGIYREK 314 P T I+ ++ Sbjct: 626 PQTAIFADE 634 Score = 24.3 bits (51), Expect = 0.009 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Query: 206 GRVGDSP-LVGAGCYANNASVAVSCTGTGEVF 236 GR DSP ++G G +A+VAV G G V+ Sbjct: 232 GRPSDSPAMIGVGV-DESAAVAVEADGRGRVY 262 Lambda K H 0.316 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 570 Number of extensions: 43 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 321 Length of database: 639 Length adjustment: 33 Effective length of query: 288 Effective length of database: 606 Effective search space: 174528 Effective search space used: 174528 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory