Align BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate Ga0059261_3653 Ga0059261_3653 phosphate ABC transporter ATP-binding protein, PhoT family (TC 3.A.1.7.1)
Query= TCDB::Q52666 (263 letters) >FitnessBrowser__Korea:Ga0059261_3653 Length = 276 Score = 120 bits (301), Expect = 3e-32 Identities = 78/241 (32%), Positives = 126/241 (52%), Gaps = 12/241 (4%) Query: 28 MNKWYGQFHVLRDINLTVHRGERIVIAGPSGSGKSTMIRCINRLEE-----HQSGKIIVD 82 +N +YG+ +RD+++ V GPSG GKST +R +NR+ + G+I +D Sbjct: 34 VNVFYGEKQAIRDVSIDVDMENVTAFIGPSGCGKSTFLRTLNRMNDTVASARVEGEITLD 93 Query: 83 GIELTSDLKNIDKVRSEVGMVFQHFNLFPHLTILENLTLAP-IWVRKVPKREAEETAMYY 141 G + ++ ++R+ VGMVFQ N FP +I EN+ P I K + ++ Sbjct: 94 GENIYDKSMDVVQLRARVGMVFQKPNPFPK-SIYENVAYGPRIHGLARAKGDMDQIVERS 152 Query: 142 LEKVKIPEQAQKYPGQ----LSGGQQQRVAIARSLCMKPKIMLFDEPTSALDPEMIKEVL 197 L++ + E+ + LSGGQQQR+ IAR++ + P+++L DEP SALDP + + Sbjct: 153 LKRAGLWEEVKDRLNDSGTALSGGQQQRLCIARAIAVDPEVILMDEPCSALDP-IATAKI 211 Query: 198 DTMIQLAEEGMTMLCVTHEMGFAQAVANRVIFMADGQIVEQNNPHDFFHNPQSERTKQFL 257 + +I ++ VTH M A V+ R F G +VE F P+ ERTK ++ Sbjct: 212 EELIHELRGRYAIVIVTHNMQQAARVSQRTAFFHLGTLVEYGETDQIFTAPRQERTKDYI 271 Query: 258 S 258 + Sbjct: 272 T 272 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 154 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 276 Length adjustment: 25 Effective length of query: 238 Effective length of database: 251 Effective search space: 59738 Effective search space used: 59738 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory