Align ATPase (characterized, see rationale)
to candidate Ga0059261_0341 Ga0059261_0341 ABC-type antimicrobial peptide transport system, ATPase component
Query= uniprot:Q31RN8 (261 letters) >FitnessBrowser__Korea:Ga0059261_0341 Length = 224 Score = 129 bits (323), Expect = 7e-35 Identities = 85/223 (38%), Positives = 125/223 (56%), Gaps = 12/223 (5%) Query: 19 ETMIYAEGVEKWY---GNQFQALCGVSLTVQRGEVVVMMGPSGSGKSTFLRTLNALESHQ 75 E ++ G+++ + G L G+ LTV +GE+V ++GPSGSGKST L+ + LE Sbjct: 3 EPVLQTSGLKRTFSQGGADIHVLRGIDLTVGQGEIVALLGPSGSGKSTLLQAVGLLEGGF 62 Query: 76 RGEIWIEGHRL----SHDRRDIATIRQEVGMVFQQFNLFPHLTVLQNLMLAPVQVRRWPV 131 G I I G + SH R T R ++G V+Q +L P L+N+ L P ++ + Sbjct: 63 EGSIRISGVEVGKLESHART--VTRRDKLGFVYQFHHLLPDFNALENVEL-PQLIQNATL 119 Query: 132 AQAEATARQLLERVRIAEQADKYPGQLSGGQQQRVAIARALAMQPRILLFDEPTSALDPE 191 A A A + LL + + + P QLSGG+QQRVA+ARALA +P ++L DEPT LD Sbjct: 120 ADARARSEGLLTALGLGARLTHRPSQLSGGEQQRVAVARALANRPALVLADEPTGNLDEH 179 Query: 192 MVREVL-DVMRDLASEGMTMLVATHEVGFAREVADRVVLMADG 233 VL + +R + EG L+ATH A ++ DRVV + +G Sbjct: 180 TADIVLAEFLRLVRGEGAAALIATHNERLAAKM-DRVVRLHEG 221 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 224 Length adjustment: 23 Effective length of query: 238 Effective length of database: 201 Effective search space: 47838 Effective search space used: 47838 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory