Align ATPase (characterized, see rationale)
to candidate Ga0059261_3874 Ga0059261_3874 ABC-type antimicrobial peptide transport system, ATPase component
Query= uniprot:Q31RN8 (261 letters) >FitnessBrowser__Korea:Ga0059261_3874 Length = 243 Score = 135 bits (341), Expect = 6e-37 Identities = 88/211 (41%), Positives = 123/211 (58%), Gaps = 7/211 (3%) Query: 36 QALCGVSLTVQRGEVVVMMGPSGSGKSTFLRTLNALESHQRGEIWIEGH---RLSHDRRD 92 Q L GVS++V GE+ +++GPSG GKST L L+ L +GE+ G+ R+ RD Sbjct: 26 QILFGVSVSVMPGELTLVVGPSGCGKSTLLAILSGLTLPDQGEVDALGNPICRMKAGARD 85 Query: 93 IATIRQEVGMVFQQFNLFPHLTVLQNLMLAPVQVRRWPVAQAEATARQLLERVRIAEQAD 152 + G VFQ FNLF LT + + +Q + A+A AR LE V + + Sbjct: 86 AFRLAN-TGFVFQGFNLFNALTAEEQVAYV-LQCMKVKPAEARQRARAALEAVGLGPRMR 143 Query: 153 KYPGQLSGGQQQRVAIARALAMQPRILLFDEPTSALDPEMVREVLDVMRDLA-SEGMTML 211 P +LSGG++QRVAIARALA QPRIL DEPTSALD V+ ++RD+A ++G +L Sbjct: 144 LRPFELSGGEKQRVAIARALAKQPRILFADEPTSALDSHNGHAVIALLRDIAHNQGAAVL 203 Query: 212 VATHEVGFAREVADRVVLMADGQIVEEAPPD 242 TH+ ADR++ M DG+I+ + PD Sbjct: 204 CVTHDPRLL-SFADRIIHMEDGRIIRDERPD 233 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 243 Length adjustment: 24 Effective length of query: 237 Effective length of database: 219 Effective search space: 51903 Effective search space used: 51903 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory