Align BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate Ga0059261_1321 Ga0059261_1321 ABC-type antimicrobial peptide transport system, ATPase component
Query= TCDB::Q52666 (263 letters) >FitnessBrowser__Korea:Ga0059261_1321 Length = 238 Score = 119 bits (299), Expect = 4e-32 Identities = 78/220 (35%), Positives = 119/220 (54%), Gaps = 9/220 (4%) Query: 23 IQISQMNKWYGQ----FHVLRDINLTVHRGERIVIAGPSGSGKSTMIRCINRLEEHQSGK 78 I++ + K +G+ F L+ ++L + + + + GPSGSGKST + + L+ SG+ Sbjct: 8 IRLRNITKVFGEGATAFQALKGVDLDIAERDFVAVMGPSGSGKSTTMNILGCLDVPTSGE 67 Query: 79 IIVDGIEL-TSDLKNIDKVRSE-VGMVFQHFNLFPHLTILENLTLAPIWVRKVPKREAEE 136 + G+ + T D VR + +G VFQ FNL LEN+ L P+ R K+ E Sbjct: 68 FLFKGVYIETLDRDQRALVRRKYLGFVFQGFNLLSRTNALENVEL-PLLYRGEDKKVRHE 126 Query: 137 TAMYYLEKVKIPEQAQKYPGQLSGGQQQRVAIARSLCMKPKIMLFDEPTSALDPEMIKEV 196 M LEKV + + P +LSGGQ QRVAIAR++ P ++L DEPT LD E+ Sbjct: 127 LGMAALEKVGLADWWDHTPAELSGGQPQRVAIARAIVTSPAVLLADEPTGNLDSARSVEI 186 Query: 197 LDTMIQL-AEEGMTMLCVTHEMGFAQAVANRVIFMADGQI 235 ++ + L + G+T+L VTHE A A A ++ DG + Sbjct: 187 MELLTSLNKDSGITVLMVTHEPDMA-AFARTIVHFKDGLV 225 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 136 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 238 Length adjustment: 24 Effective length of query: 239 Effective length of database: 214 Effective search space: 51146 Effective search space used: 51146 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory