Align ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized)
to candidate Ga0059261_3668 Ga0059261_3668 ABC transporter
Query= reanno::Smeli:SMc04256 (361 letters) >FitnessBrowser__Korea:Ga0059261_3668 Length = 201 Score = 100 bits (249), Expect = 3e-26 Identities = 71/191 (37%), Positives = 102/191 (53%), Gaps = 14/191 (7%) Query: 21 RLNLDIDHGE-FLVLLGSSGCGKSTLLNCIAGLLDVSDGQIFIKDRNV----TWEE--PK 73 +++ I+ GE +VL G SG GK+++L+ +AGLL+ G + + + E+ P+ Sbjct: 15 QISCRIEGGEGIIVLFGPSGVGKTSVLDMVAGLLEPDTGHVRVGGETLFDAAIGEDVPPE 74 Query: 74 DRGIGMVFQSYALYPQMTVEKNLSFGLKVAKIPPAEIEKRVKRASEILQIQPLLKRKPSE 133 R G VFQ L+P ++V NL +G A P+ + R I LL R P Sbjct: 75 RRRAGYVFQDARLFPHLSVRANLLYG---AGGDPSGLGDLAAR----FDIAHLLDRWPRS 127 Query: 134 LSGGQRQRVAIGRALVRDVDVFLFDEPLSNLDAKLRSELRVEIKRLHQSLKNTMIYVTHD 193 LSGG+ +RVAIGRAL+ L DEPLS+LD R E+ I+RL ++ VTHD Sbjct: 128 LSGGEARRVAIGRALLAKPRFLLLDEPLSSLDRARREEVTRVIERLRDEAALPILMVTHD 187 Query: 194 QIEALTLADRI 204 +EA L RI Sbjct: 188 PVEAERLGQRI 198 Lambda K H 0.320 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 199 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 201 Length adjustment: 25 Effective length of query: 336 Effective length of database: 176 Effective search space: 59136 Effective search space used: 59136 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory