Align CbtF, component of Cellobiose and cellooligosaccharide porter (characterized)
to candidate Ga0059261_2293 Ga0059261_2293 cell division ATP-binding protein FtsE
Query= TCDB::Q97VF4 (324 letters) >FitnessBrowser__Korea:Ga0059261_2293 Length = 235 Score = 87.4 bits (215), Expect = 3e-22 Identities = 66/207 (31%), Positives = 106/207 (51%), Gaps = 7/207 (3%) Query: 10 SVIFEDKVGLFKKRKFYALKDVSLSMNQGDLLIVLGESGAGKTTLGRVIVGLQKPTSGEV 69 +++ + VGL L DVS +++ G V G SGAGKT+L R++ Q+PT G V Sbjct: 3 NIVQFENVGLRYGTGAETLSDVSFTLSAGSFYFVTGASGAGKTSLLRLLYLAQRPTRGIV 62 Query: 70 VYDGYNIWKNKRKIFKKYRKDVQLIPQDPYSTLPFNKTVEEILVAPILRWEKINKDELRK 129 G + RK +R+ + ++ QD + LP + VA LR I + ++ Sbjct: 63 RLFGEDAGALPRKRLPGFRRRIGVVFQD-FRLLPHLSAYDN--VALPLRVAGIPEADIEG 119 Query: 130 RLINLLELVKLTPAEEFLGKYPHQLSGGQKQRLSIARSLSVNPRIIVADEPVTMVDASLR 189 + ++ V L + P LSGG++QR++IAR++ P I++ADEP VD + Sbjct: 120 PVREMIAWVGLKDRD---SAKPPTLSGGEQQRIAIARAVITRPEILIADEPTGNVDPDMA 176 Query: 190 IGILNTLAEIKNRLNLTMVFITHDIPI 216 +L+ L + NRL T+V THD + Sbjct: 177 ERLLH-LFDSLNRLGTTVVVATHDFQL 202 Lambda K H 0.321 0.141 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 177 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 235 Length adjustment: 25 Effective length of query: 299 Effective length of database: 210 Effective search space: 62790 Effective search space used: 62790 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory