GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ptsG-crr in Sphingomonas koreensis DSMZ 15582

Align PTS system glucose-specific EIICBA component; EC 2.7.1.-; EC 2.7.1.69 (characterized)
to candidate Ga0059261_1647 Ga0059261_1647 PTS system, N-acetylglucosamine-specific IIBC component

Query= CharProtDB::CH_001857
         (699 letters)



>lcl|FitnessBrowser__Korea:Ga0059261_1647 Ga0059261_1647 PTS system,
           N-acetylglucosamine-specific IIBC component
          Length = 560

 Score =  340 bits (872), Expect = 1e-97
 Identities = 203/518 (39%), Positives = 294/518 (56%), Gaps = 42/518 (8%)

Query: 3   KALFGVLQKIGRALMLPVAILPAAGILLAIGNAMQNKDMIQVLHFLSNDNVQLVAGVMES 62
           + +   LQ +GRALMLP+A+LP AG+LL IG      D++ +               + +
Sbjct: 2   RKILETLQPLGRALMLPIAVLPVAGLLLRIGQP----DLLDI-------------AFVSA 44

Query: 63  AGQIVFDNLPLLFAVGVAIGLA-NGDGVAGIAAIIGYLVMNVSMSAVLLANGTIPSDSVE 121
           AG  +F NL +LFA+GVA+G A +G+G A +A +  YLV        L+A   + +   +
Sbjct: 45  AGTAIFGNLGILFAIGVAVGFARDGNGAAALAGVTCYLVSTTGAQTFLIAPPEVVAGLPD 104

Query: 122 RAKFFTENHPA--YVNMLGIPTLATGVFGGIIVGVLAALLFNRFYTIELPQYLGFFAGKR 179
            A        A   ++ L +P        GII G++    +NRF TI LP+YL FF G+R
Sbjct: 105 AAAKVVAQAWATGQIDRLEVPI-------GIISGLIGGKFYNRFATIALPEYLAFFGGRR 157

Query: 180 FVPIVTSISALILGLIMLVIWPPIQHGLNAFSTGLVEANPTLAAFIFGVIERSLIPFGLH 239
           FVPI   I+ L+L  ++   +  I   L+A S  +VE+      F++GV+ R L+  GLH
Sbjct: 158 FVPIAAGIAGLLLAGVLGYGYAHISSALDAASHAVVESGGA-GMFVYGVLNRLLLVTGLH 216

Query: 240 HIFYSPFWYEFFSYKSAAGEIIRGDQRIFMAQIKDGVQLTAGTFMTGKYPFMMFGLPAAA 299
           H+  +  W+    +  A G++ R     F A   +     AG FM+G +P MMFGLPAA 
Sbjct: 217 HLLNNVAWFLVGDFGGATGDLGR-----FFAGDPN-----AGAFMSGFFPVMMFGLPAAC 266

Query: 300 LAIYHEAKPQNKKLVAGIMGSAALTSFLTGITEPLEFSFLFVAPVLFAIHCLFAGLSFMV 359
           LA+YHEA+P+ +K V G++ S A TSFLTG+TEP+EF+F+F+APVL+AIH +  G++  +
Sbjct: 267 LAMYHEARPERRKAVGGMLFSLAFTSFLTGVTEPIEFTFMFLAPVLYAIHAVLTGVAMTL 326

Query: 360 MQLLNVKIGMTFSGGLIDYFLFGILPNRTAWWLVIPVGLGLAVIYYFGFRFAIRKFNLKT 419
           M +L +K+G  FS GL DY L   L  R   W+++PVG   AVIYY  FRF IRK +L T
Sbjct: 327 MDMLGIKLGFGFSAGLFDYVLNFKLSTRP--WMLLPVGAAYAVIYYTLFRFFIRKLDLAT 384

Query: 420 PGREDAAEETAAPGKTGEAGDLPYEILQAMGDQENIKHLDACITRLRVTVNDQKKVDKDR 479
           PGRE   E  AA G+T    +     ++A+G   N+  +DAC TRLR+ V DQ  VD   
Sbjct: 385 PGRE-KGEAVAAAGETAAGNERGAAFVKALGGAANLTSVDACTTRLRLIVADQSAVDDAA 443

Query: 480 LKQLGASGVLE-VGNNIQAIFGPRSDGLKTQMQDIIAG 516
           L  LGA G++    N  Q + GP +D +  +++  I G
Sbjct: 444 LNALGARGIIRPSANATQVVLGPIADLVAEEIRGAIGG 481



 Score = 35.4 bits (80), Expect = 7e-06
 Identities = 24/58 (41%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 425 AAEETAAPGKT--GEAGDLPYEILQAMGDQENIKHLDACITRLRVTVNDQKKVDKDRL 480
           AA  +AAP +    EA  LP  IL A+G + NI+ L A   R RV V D  + D+  L
Sbjct: 483 AAAVSAAPAQALADEAVTLPAAILAALGGEANIRALQALHGRFRVEVVDAARTDEASL 540


Lambda     K      H
   0.323    0.141    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1051
Number of extensions: 67
Number of successful extensions: 9
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 699
Length of database: 560
Length adjustment: 38
Effective length of query: 661
Effective length of database: 522
Effective search space:   345042
Effective search space used:   345042
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory