Align citrate lyase β subunit (EC 4.1.3.34) (characterized)
to candidate Ga0059261_0570 Ga0059261_0570 Citrate lyase beta subunit
Query= metacyc::MONOMER-16999 (289 letters) >FitnessBrowser__Korea:Ga0059261_0570 Length = 273 Score = 132 bits (331), Expect = 1e-35 Identities = 92/281 (32%), Positives = 138/281 (49%), Gaps = 17/281 (6%) Query: 5 RSMLFIPGANAAMLSTSFVYGADAVMFDLEDAVSLREKDTAR--LLVYQALQHPLYQDIE 62 RS LF+P + + ADA+ FDLED+V K AR L + A Sbjct: 2 RSKLFVPCSRPEFFDKALASAADALSFDLEDSVPADGKAAARARLAAFLASDAVRGTPKR 61 Query: 63 TVVRINPLNTPFGLADLEAVVRAGVDMVRLPKTDSKEDIHELEAHVERIERECGREVGST 122 +VR+N P AD+EA+ +D++ LPK + V GR +G Sbjct: 62 IIVRVNDPAGPDFTADIEAIRNCRIDLINLPKIEDAPG-------VIAAANATGRAIG-- 112 Query: 123 KLMAAIESALGVVNAVEIARASPRLAAIALAAFDYVMDMGTSRGDGTELFYARCAVLHAA 182 L+ IE+ ++ A IA A PR+A + + D +G R D + A + A Sbjct: 113 -LLVNIETPHALMRAAAIANAHPRVAGLQVGLNDLFATLGADRRDPRAVHAALWQIRLGA 171 Query: 183 RVAGIAAYDVVWSDINNEEGFLAEANLAKNLGFNGKSLVNPRQIELLHQVYAPTRKEVDH 242 AGI AYD W D+ +E GF AEA +A+ LG+ GKS ++PRQI ++V+ T +D Sbjct: 172 AAAGIFAYDGAWPDLADEAGFRAEAGMAQALGYMGKSCIHPRQIAAANEVFDHT---LDR 228 Query: 243 AL--EVIAAAEEAETRGLGVVSLNGKMIDGPIIDHARKVVA 281 A+ ++AAA+ A G G G+M+D P+I A+ ++A Sbjct: 229 AVARRLVAAAQAAALDGRGAFLFEGRMVDRPMIAQAQALLA 269 Lambda K H 0.319 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 194 Number of extensions: 10 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 273 Length adjustment: 26 Effective length of query: 263 Effective length of database: 247 Effective search space: 64961 Effective search space used: 64961 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory